Property Summary

NCBI Gene PubMed Count 62
PubMed Score 48.38
PubTator Score 57.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Endometrial cancer 311 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 2.7
Disease Target Count Z-score Confidence
Paraplegia 74 5.588 2.8
Neuropathy 261 3.261 1.6

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.500 3.9e-03
astrocytic glioma -1.900 1.7e-03
Astrocytoma, Pilocytic -1.700 2.4e-05
atypical teratoid / rhabdoid tumor -2.800 6.1e-08
ependymoma -2.400 5.5e-04
facioscapulohumeral dystrophy 3.000 2.2e-07
glioblastoma -2.000 1.6e-07
group 3 medulloblastoma -2.600 1.3e-03
lung cancer 2.100 3.2e-05
lung carcinoma 3.400 5.7e-63
medulloblastoma, large-cell -2.200 1.3e-03
oligodendroglioma -1.800 6.2e-03
osteosarcoma 1.487 8.5e-08
ovarian cancer 1.200 1.6e-10
Pick disease -1.400 5.5e-04
primitive neuroectodermal tumor -2.200 1.8e-04
psoriasis 1.400 7.3e-05
subependymal giant cell astrocytoma -1.451 4.6e-02

 GWAS Trait (1)

Gene RIF (40)

AA Sequence

MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQEQVYHACAMQI      1 - 70
VKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHIYSMDENLEFHIKVSYFEIYL     71 - 140
DKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEILDVIDEGKSNRHVAVTNMNEHSSRSHSIFL    141 - 210
INIKQENMETEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYR    211 - 280
DSKMTRILQDSLGGNCRTTMFICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEK    281 - 350
EKTKAQKETIAKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE    351 - 420
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAAKDEVKEVLQA    421 - 490
LEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVSGHQRKRIAEVLNGLMKDLSE    491 - 560
FSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKSVVKRCRQLENLQVECHRKMEVTGRELSSCQ    561 - 630
LLISQHEAKIRSLTEYMQSVELKKRHLEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALE    631 - 700
LQMESHREAHHRQLARLRDEINEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLY    701 - 770
ERHEQSKQDLKGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL    771 - 840
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRIKEAVRYKSSG    841 - 910
KRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGA    911 - 980
TSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS                      981 - 1032
//

Text Mined References (66)

PMID Year Title