Property Summary

NCBI Gene PubMed Count 26
Grant Count 24
R01 Count 17
Funding $1,790,413.21
PubMed Score 128.72
PubTator Score 48.30

Knowledge Summary

Patent

No data available

Gene RIF (10)

PMID Text
25740067 ZO4 is highly expressed in ovarian tissue in PCOS patients with regular cycle and without hyperandrogenism; in some patients with PCOS and infertility, ZP4 mutation can be found.
21173071 Human ZP4 is not sufficient to support human sperm binding to the zona pellucida in transgenic mice; other zona proteins may be needed for human gamete recognition.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)
19625618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19004505 a significant decrease in acrosomal exocytosis mediated by both recombinant human ZP3 (p<0.005) and ZP4 (p<0.005) was observed in presence of the immune sera
18667750 induces acrosome reactions which are protein kinase-C, protein tyrosine kinase, T-type Ca2+ channels, and extracellular Ca2+ dependent
16407501 Exposure of sperm to ZP proteins promoted acrosomal exocytosis and changed motility patterns.
15950651 Binding sites for recombinant zona pellucida B (ZPB) glycoprotein are located both at the N- and C-terminus of proacrosin
15805145 ZPB induces acrosomal exocytosis through a Gi independent pathway.

AA Sequence

MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEATSPPVLIAWDNQGLLHELQND      1 - 70
SDCGTWIRKGPGSSVVLEATYSSCYVTEWDSHYIMPVGVEGAGAAEHKVVTERKLLKCPMDLLARDAPDT     71 - 140
DWCDSIPARDRLPCAPSPISRGDCEGLGCCYSSEEVNSCYYGNTVTLHCTREGHFSIAVSRNVTSPPLLL    141 - 210
DSVRLALRNDSACNPVMATQAFVLFQFPFTSCGTTRQITGDRAVYENELVATRDVKNGSRGSVTRDSIFR    211 - 280
LHVSCSYSVSSNSLPINVQVFTLPPPFPETQPGPLTLELQIAKDKNYGSYYGVGDYPVVKLLRDPIYVEV    281 - 350
SILHRTDPYLGLLLQQCWATPSTDPLSQPQWPILVKGCPYIGDNYQTQLIPVQKALDLPFPSHHQRFSIF    351 - 420
TFSFVNPTVEKQALRGPVHLHCSVSVCQPAETPSCVVTCPDLSRRRNFDNSSQNTTASVSSKGPMILLQA    421 - 490
TKDPPEKLRVPVDSKVLWVAGLSGTLILGALLVSYLAVKKQKSCPDQMCQ                        491 - 540
//

Text Mined References (27)

PMID Year Title
26329136 2015 Human sperm degradation of zona pellucida proteins contributes to fertilization.
25740067 2015 Study on the zona pellucida 4 (ZP4) gene sequence and its expression in the ovaries of patients with polycystic ovary syndrome.
21173071 2011 Human ZP4 is not sufficient for taxon-specific sperm recognition of the zona pellucida in transgenic mice.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
20394732 2010 Recombinant human ZP3-induced sperm acrosome reaction: evidence for the involvement of T- and L-type voltage-gated calcium channels.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
19625618 2009 Three susceptible loci associated with primary open-angle glaucoma identified by genome-wide association study in a Japanese population.
19004505 2009 DNA vaccine encoding chimeric protein encompassing epitopes of human ZP3 and ZP4: immunogenicity and characterization of antibodies.
18667750 2008 Effects of native human zona pellucida glycoproteins 3 and 4 on acrosome reaction and zona pellucida binding of human spermatozoa.
More...