Property Summary

NCBI Gene PubMed Count 132
Grant Count 174
R01 Count 130
Funding $15,245,259.36
PubMed Score 383.95
PubTator Score 222.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12834 B2R6Z6 D3DPJ1 Q5JUY4 Q9BW56 Q9UQI9
Symbols CDC20A
p55CDC
bA276H19.3

Gene

PANTHER Protein Class (1)

PDB

5G04   5KHR   5LCW   4GGA   4GGC   4GGD   4N14  

Gene RIF (75)

PMID Text
26960431 Study describes a positive feedback loop centred on cyclin A2-Cdk2 inhibition of interphase APC/C-Cdc20 to allow further cyclin A2 accumulation and mitotic entry.
26912231 Bub1-Plk1-mediated phosphorylation of Cdc20 constitutes an anaphase-promoting complex or cyclosome-inhibitory mechanism that is parallel, but not redundant, to mitotic checkpoint complex formation.
26626260 Results show that CYP1B1 may promote renal cell carcinoma development by inducing CDC20 expression and inhibiting apoptosis through the down-regulation of DAPK1.
26148513 The presence of this segment correlates with SAC activity and efficient binding of CDC20 but not of MAD1 to kinetochores.
26074073 CDC20 is essential for the in vivo tumorigenicity of glioblastoma stem-like cells. CDC20 is prognostic of overall survival in Proneural subtype glioblastoma patients.
25938542 These results suggest CDC20 is a critical regulator of TIC proliferation and survival, linking two key TIC nodes-FOXM1 and p21CIP1/WAF1-elucidating a potential point for therapeutic intervention.
25698537 BUB1B expression was highly correlated to CDC20 and CCNB1 expression in multiple myeloma cells, leading to increased cell proliferation.
25673878 spindle checkpoint release further increases APC/C(Cdc20) catalytic activity
25669885 The ABBA motif in cyclin A is required for its proper degradation in prometaphase through competing with BUBR1 for the same site on CDC20
25637637 CDC20, MAD2 and Aurora-B protein expression are associated with chromosomal abnormalities and poor prognosis in patients with myelodysplastic syndromes.
More...

AA Sequence

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTT      1 - 70
PSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNA     71 - 140
PEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWS    141 - 210
ASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYI    211 - 280
LSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQT    281 - 350
FTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF    351 - 420
AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAK    421 - 490
SSLIHQGIR                                                                 491 - 499
//

Text Mined References (139)

PMID Year Title
26960431 2016 Interphase APC/C-Cdc20 inhibition by cyclin A2-Cdk2 ensures efficient mitotic entry.
26912231 2016 The Bub1-Plk1 kinase complex promotes spindle checkpoint signalling through Cdc20 phosphorylation.
26626260 2015 CYP1B1 promotes tumorigenesis via altered expression of CDC20 and DAPK1 genes in renal cell carcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26148513 2015 Dissecting the roles of human BUB1 in the spindle assembly checkpoint.
26074073 2015 A CDC20-APC/SOX2 Signaling Axis Regulates Human Glioblastoma Stem-like Cells.
25938542 2015 CDC20 maintains tumor initiating cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25698537 2015 BUB1B promotes multiple myeloma cell proliferation through CDC20/CCNB axis.
25673878 2015 Nek2A destruction marks APC/C activation at the prophase-to-prometaphase transition by spindle-checkpoint-restricted Cdc20.
More...