Property Summary

NCBI Gene PubMed Count 148
PubMed Score 401.48
PubTator Score 222.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 2.419 1.5e-03
adult high grade glioma 1.500 1.9e-03
Atopic dermatitis 2.200 3.8e-05
atypical teratoid / rhabdoid tumor 2.700 1.1e-09
Breast cancer 2.600 4.1e-12
breast carcinoma 1.800 9.0e-30
colon cancer 1.400 1.4e-02
ductal carcinoma in situ 2.000 7.7e-03
Endometriosis 1.923 8.8e-03
esophageal adenocarcinoma 1.200 4.0e-02
glioblastoma 2.300 3.2e-07
group 3 medulloblastoma 4.000 8.8e-07
interstitial cystitis 1.300 1.4e-02
intraductal papillary-mucinous carcinoma... 2.700 2.0e-05
intraductal papillary-mucinous neoplasm ... 3.300 8.5e-05
invasive ductal carcinoma 2.800 2.2e-04
lung adenocarcinoma 1.500 1.7e-14
lung cancer 1.200 3.9e-02
malignant mesothelioma 1.300 7.7e-06
medulloblastoma, large-cell 3.400 4.2e-07
non-small cell lung cancer 4.130 1.2e-40
osteosarcoma -1.936 3.7e-02
ovarian cancer 1.200 1.4e-02
pancreatic cancer 1.600 1.6e-04
posterior fossa group A ependymoma 1.400 4.5e-03
primitive neuroectodermal tumor 3.200 1.9e-05
psoriasis 1.300 3.4e-05

Gene RIF (83)

AA Sequence

MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTT      1 - 70
PSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNA     71 - 140
PEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWS    141 - 210
ASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYI    211 - 280
LSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQT    281 - 350
FTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGF    351 - 420
AQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAK    421 - 490
SSLIHQGIR                                                                 491 - 499
//

Text Mined References (155)

PMID Year Title