Property Summary

NCBI Gene PubMed Count 35
Grant Count 24
R01 Count 15
Funding $3,746,097.71
PubMed Score 53.19
PubTator Score 43.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.038
ependymoma 1.400 0.004
oligodendroglioma 1.500 0.007
osteosarcoma -1.255 0.005
glioblastoma 1.300 0.000
medulloblastoma 1.300 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.900 0.000
primary pancreatic ductal adenocarcinoma 1.011 0.009
tuberculosis -1.100 0.000
pediatric high grade glioma 1.300 0.000
spina bifida -1.189 0.032
invasive ductal carcinoma 1.300 0.004
ovarian cancer 1.600 0.000

Gene RIF (10)

PMID Text
26899553 somatic frameshift mutations of BPTF were present in gastric cancer and colorectal cancers
26418899 BPTF plays an essential role in cell growth and survival by targeting multiply signaling pathways in human lung cancers
25716692 High BPTF expression was significantly correlated with tumor progression and may be a potent prognostic marker of colorectal cancer.
25362514 expression may be marker for survival prediction in hepatocellular carcinoma
21596426 The PHD-adjacent bromodomain in BPTF binds with marked selectivity H4K16ac, in combination with H3K4me3 at the mononucleosome level.
20300178 the novel translocation breakpoint within the BPTF gene is associated with a pre-malignant phenotype
19190132 High FALZ expression is associated with metastatic spread to the brain in primary non-small cell lung cancer.
16728978 crystallographic and NMR structures of the bromodomain-proximal PHD finger of BPTF in free and H3(1-15)K4me3-bound states
16137655 These findings suggest a role for FAC1 in apoptosis following release of Nrf2 from Keap1 in response to oxidative stress.
15379550 hkelch-like ECH-associated protein 1 regulates FAC1 in addition to its known role in control of Nrf2

AA Sequence

MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPTSGPIGGLRSRHRGSSRGRWAAAQAEVAPKTRLSSPRGG      1 - 70
SSSRRKPPPPPPAPPSTSAPGRGGRGGGGGRTGGGGGGGHLARTTAARRAVNKVVYDDHESEEEEEEEDM     71 - 140
VSEEEEEEDGDAEETQDSEDDEEDEMEEDDDDSDYPEEMEDDDDDASYCTESSFRSHSTYSSTPGRRKPR    141 - 210
VHRPRSPILEEKDIPPLEFPKSSEDLMVPNEHIMNVIAIYEVLRNFGTVLRLSPFRFEDFCAALVSQEQC    211 - 280
TLMAEMHVVLLKAVLREEDTSNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAE    281 - 350
DYPYGPVENKIKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPP    351 - 420
LEEVPEDEWQCEVCVAHKVPGVTDCVAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIEEDTENENEKK    421 - 490
IWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNKARGSNKSFLAAANEEILESI    491 - 560
RAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQSLEKDSDDKTPDDDPEQGKSEEPTEVGDKG    561 - 630
NSVSANLGDNTTNATSEETSPSEGRSPVGCLSETPDSSNMAEKKVASELPQDVPEEPNKTCESSNTSATT    631 - 700
TSIQPNLENSNSSSELNSSQSESAKAADDPENGERESHTPVSIQEEIVGDFKSEKSNGELSESPGAGKGA    701 - 770
SGSTRIITRLRNPDSKLSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYF    771 - 840
KLGQEGKYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTLRLTI    841 - 910
TQLENNIPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPVVMLPIWRESLGHTRLHRMTS    911 - 980
IEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVWKQKGEEYRVTGYGGWSWISKTHVYRFVPKLP    981 - 1050
GNTNVNYRKSLEGTKNNMDENMDESDKRKCSRSPKKIKIEPDSEKDEVKGSDAAKGADQNEMDISKITEK   1051 - 1120
KDQDVKELLDSDSDKPCKEEPMEVDDDMKTESHVNCQESSQVDVVNVSEGFHLRTSYKKKTKSSKLDGLL   1121 - 1190
ERRIKQFTLEEKQRLEKIKLEGGIKGIGKTSTNSSKNLSESPVITKAKEGCQSDSMRQEQSPNANNDQPE   1191 - 1260
DLIQGCSESDSSVLRMSDPSHTTNKLYPKDRVLDDVSIRSPETKCPKQNSIENDIEEKVSDLASRGQEPS   1261 - 1330
KSKTKGNDFFIDDSKLASADDIGTLICKNKKPLIQEESDTIVSSSKSALHSSVPKSTNDRDATPLSRAMD   1331 - 1400
FEGKLGCDSESNSTLENSSDTVSIQDSSEEDMIVQNSNESISEQFRTREQDVEVLEPLKCELVSGESTGN   1401 - 1470
CEDRLPVKGTEANGKKPSQQKKLEERPVNKCSDQIKLKNTTDKKNNENRESEKKGQRTSTFQINGKDNKP   1471 - 1540
KIYLKGECLKEISESRVVSGNVEPKVNNINKIIPENDIKSLTVKESAIRPFINGDVIMEDFNERNSSETK   1541 - 1610
SHLLSSSDAEGNYRDSLETLPSTKESDSTQTTTPSASCPESNSVNQVEDMEIETSEVKKVTSSPITSEEE   1611 - 1680
SNLSNDFIDENGLPINKNENVNGESKRKTVITEVTTMTSTVATESKTVIKVEKGDKQTVVSSTENCAKST   1681 - 1750
VTTTTTTVTKLSTPSTGGSVDIISVKEQSKTVVTTTVTDSLTTTGGTLVTSMTVSKEYSTRDKVKLMKFS   1751 - 1820
RPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARKGGIREVPYFNYNAKPALDIWPYPSPRPTFG   1821 - 1890
ITWRYRLQTVKSLAGVSLMLRLLWASLRWDDMAAKAPPGGGTTRTETSETEITTTEIIKRRDVGPYGIRS   1891 - 1960
EYCIRKIICPIGVPETPKETPTPQRKGLRSSALRPKRPETPKQTGPVIIETWVAEEELELWEIRAFAERV   1961 - 2030
EKEKAQAVEQQAKKRLEQQKPTVIATSTTSPTSSTTSTISPAQKVMVAPISGSVTTGTKMVLTTKVGSPA   2031 - 2100
TVTFQQNKNFHQTFATWVKQGQSNSGVVQVQQKVLGIIPSSTGTSQQTFTSFQPRTATVTIRPNTSGSGG   2101 - 2170
TTSNSQVITGPQIRPGMTVIRTPLQQSTLGKAIIRTPVMVQPGAPQQVMTQIIRGQPVSTAVSAPNTVSS   2171 - 2240
TPGQKSLTSATSTSNIQSSASQPPRPQQGQVKLTMAQLTQLTQGHGGNQGLTVVIQGQGQTTGQLQLIPQ   2241 - 2310
GVTVLPGPGQQLMQAAMPNGTVQRFLFTPLATTATTASTTTTTVSTTAAGTGEQRQSKLSPQMQVHQDKT   2311 - 2380
LPPAQSSSVGPAEAQPQTAQPSAQPQPQTQPQSPAQPEVQTQPEVQTQTTVSSHVPSEAQPTHAQSSKPQ   2381 - 2450
VAAQSQPQSNVQGQSPVRVQSPSQTRIRPSTPSQLSPGQQSQVQTTTSQPIPIQPHTSLQIPSQGQPQSQ   2451 - 2520
PQVQSSTQTLSSGQTLNQVTVSSPSRPQLQIQQPQPQVIAVPQLQQQVQVLSQIQSQVVAQIQAQQSGVP   2521 - 2590
QQIKLQLPIQIQQSSAVQTHQIQNVVTVQAASVQEQLQRVQQLRDQQQKKKQQQIEIKREHTLQASNQSE   2591 - 2660
IIQKQVVMKHNAVIEHLKQKKSMTPAEREENQRMIVCNQVMKYILDKIDKEEKQAAKKRKREESVEQKRS   2661 - 2730
KQNATKLSALLFKHKEQLRAEILKKRALLDKDLQIEVQEELKRDLKIKKEKDLMQLAQATAVAAPCPPVT   2731 - 2800
PAPPAPPAPPPSPPPPPAVQHTGLLSTPTLPAASQKRKREEEKDSSSKSKKKKMISTTSKETKKDTKLYC   2801 - 2870
ICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVL   2871 - 2940
RSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSD   2941 - 3010
SPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS                                     3011 - 3046
//

Text Mined References (51)

PMID Year Title
27141965 2016 Setd1a and NURF mediate chromatin dynamics and gene regulation during erythroid lineage commitment and differentiation.
26899553 2016 BPTF, a chromatin remodeling-related gene, exhibits frameshift mutations in gastric and colorectal cancers.
26418899 2015 BPTF promotes tumor growth and predicts poor prognosis in lung adenocarcinomas.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25716692 2015 The prognostic significance of bromodomain PHD-finger transcription factor in colorectal carcinoma and association with vimentin and E-cadherin.
25362514 2015 BPTF Associated with EMT Indicates Negative Prognosis in Patients with Hepatocellular Carcinoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...