Property Summary

NCBI Gene PubMed Count 39
PubMed Score 57.99
PubTator Score 43.87

Knowledge Summary


No data available


  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 2.2e-07
ependymoma 1.400 4.2e-03
glioblastoma 1.300 3.4e-07
group 3 medulloblastoma 1.100 7.4e-03
invasive ductal carcinoma 1.300 4.3e-03
medulloblastoma, large-cell 1.500 2.0e-05
oligodendroglioma 1.500 7.0e-03
osteosarcoma -1.255 4.7e-03
ovarian cancer -1.300 2.2e-04
pediatric high grade glioma 1.300 9.7e-05
primary pancreatic ductal adenocarcinoma 1.011 9.5e-03
primitive neuroectodermal tumor 1.900 1.9e-04
Rheumatoid arthritis 1.500 3.8e-02
spina bifida -1.189 3.2e-02
tuberculosis -1.100 2.1e-05

Gene RIF (14)

AA Sequence

SPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS                                     3011 - 3046

Text Mined References (56)

PMID Year Title