Property Summary

NCBI Gene PubMed Count 35
PubMed Score 53.19
PubTator Score 43.87

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.23820378250161E-7
glioblastoma 5572 3.39730354374896E-7
medulloblastoma 1524 3.59442002417016E-7
medulloblastoma, large-cell 6234 2.03332591717276E-5
tuberculosis 1563 2.140584268496E-5
pediatric high grade glioma 2712 9.71835388187988E-5
primitive neuroectodermal tumor 3031 1.90094963864287E-4
ovarian cancer 8492 3.51986189005825E-4
ependymoma 2514 0.00422526524150307
invasive ductal carcinoma 2950 0.0043000842995296
osteosarcoma 7933 0.00471760575835215
oligodendroglioma 2849 0.007025839343006
primary pancreatic ductal adenocarcinoma 1271 0.0094994496844301
spina bifida 1064 0.0316834859935671
Rheumatoid Arthritis 1171 0.0376099747171121
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Adenocarcinoma 115 0.0 2.0


  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.038
ependymoma 1.400 0.004
oligodendroglioma 1.500 0.007
osteosarcoma -1.255 0.005
glioblastoma 1.300 0.000
medulloblastoma 1.300 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.900 0.000
primary pancreatic ductal adenocarcinoma 1.011 0.009
tuberculosis -1.100 0.000
pediatric high grade glioma 1.300 0.000
spina bifida -1.189 0.032
invasive ductal carcinoma 1.300 0.004
ovarian cancer 1.600 0.000


Accession Q12830 Q6NX67 Q7Z7D6 Q9UIG2
Symbols FAC1



2F6J   2F6N   2FSA   2FUI   2FUU   2RI7   3QZS   3QZT   3QZV   3UV2  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans EggNOG Inparanoid

Gene RIF (10)

26899553 somatic frameshift mutations of BPTF were present in gastric cancer and colorectal cancers
26418899 BPTF plays an essential role in cell growth and survival by targeting multiply signaling pathways in human lung cancers
25716692 High BPTF expression was significantly correlated with tumor progression and may be a potent prognostic marker of colorectal cancer.
25362514 expression may be marker for survival prediction in hepatocellular carcinoma
21596426 The PHD-adjacent bromodomain in BPTF binds with marked selectivity H4K16ac, in combination with H3K4me3 at the mononucleosome level.
20300178 the novel translocation breakpoint within the BPTF gene is associated with a pre-malignant phenotype
19190132 High FALZ expression is associated with metastatic spread to the brain in primary non-small cell lung cancer.
16728978 crystallographic and NMR structures of the bromodomain-proximal PHD finger of BPTF in free and H3(1-15)K4me3-bound states
16137655 These findings suggest a role for FAC1 in apoptosis following release of Nrf2 from Keap1 in response to oxidative stress.
15379550 hkelch-like ECH-associated protein 1 regulates FAC1 in addition to its known role in control of Nrf2

AA Sequence

SPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS                                     3011 - 3046

Text Mined References (51)

PMID Year Title
27141965 2016 Setd1a and NURF mediate chromatin dynamics and gene regulation during erythroid lineage commitment and differentiation.
26899553 2016 BPTF, a chromatin remodeling-related gene, exhibits frameshift mutations in gastric and colorectal cancers.
26418899 2015 BPTF promotes tumor growth and predicts poor prognosis in lung adenocarcinomas.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25716692 2015 The prognostic significance of bromodomain PHD-finger transcription factor in colorectal carcinoma and association with vimentin and E-cadherin.
25362514 2015 BPTF Associated with EMT Indicates Negative Prognosis in Patients with Hepatocellular Carcinoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.