Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.60
PubTator Score 8.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.10626738900897E-84
non-small cell lung cancer 2798 1.22030828354041E-22
atypical teratoid / rhabdoid tumor 4369 5.92210046982126E-10
ovarian cancer 8492 7.09045065832828E-9
medulloblastoma 1524 2.13397131855922E-8
malignant mesothelioma 3163 1.91917956685763E-7
inflammatory breast cancer 404 6.9711172361773E-6
medulloblastoma, large-cell 6234 9.58251947068548E-6
breast carcinoma 1614 1.68294763406784E-5
pediatric high grade glioma 2712 2.38630844053383E-5
Atopic dermatitis 944 1.01928670828645E-4
glioblastoma 5572 1.2991518837633E-4
primitive neuroectodermal tumor 3031 1.62910810891444E-4
invasive ductal carcinoma 2950 4.82900953971539E-4
lung cancer 4473 0.00371647425036812

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.400 0.000
psoriasis 1.600 0.000
glioblastoma 1.900 0.000
medulloblastoma 2.300 0.000
atypical teratoid / rhabdoid tumor 2.000 0.000
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 2.000 0.000
Atopic dermatitis 1.400 0.000
non-small cell lung cancer 1.705 0.000
lung cancer 1.300 0.004
breast carcinoma 2.100 0.000
pediatric high grade glioma 1.600 0.000
inflammatory breast cancer 2.200 0.000
invasive ductal carcinoma 1.300 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q12815 F8VSF9 Q6PJU7 Q8N5B2
Symbols TASTIN

Gene

  Ortholog (9)

Gene RIF (2)

PMID Text
18218922 the major function of tastin during mitosis is to maintain the structural and dynamic features of centrosomes, thereby contributing to spindle bipolarity.
12049630 plays an important role in mammalian cells by associating with the microtubular cytoskeleton

AA Sequence

MTTRQATKDPLLRGVSPTPSKIPVRSQKRTPFPTVTSCAVDQENQDPRRWVQKPPLNIQRPLVDSAGPRP      1 - 70
KARHQAETSQRLVGISQPRNPLEELRPSPRGQNVGPGPPAQTEAPGTIEFVADPAALATILSGEGVKSCH     71 - 140
LGRQPSLAKRVLVRGSQGGTTQRVQGVRASAYLAPRTPTHRLDPARASCFSRLEGPGPRGRTLCPQRLQA    141 - 210
LISPSGPSFHPSTRPSFQELRRETAGSSRTSVSQASGLLLETPVQPAFSLPKGEREVVTHSDEGGVASLG    211 - 280
LAQRVPLRENREMSHTRDSHDSHLMPSPAPVAQPLPGHVVPCPSPFGRAQRVPSPGPPTLTSYSVLRRLT    281 - 350
VQPKTRFTPMPSTPRVQQAQWLRGVSPQSCSEDPALPWEQVAVRLFDQESCIRSLEGSGKPPVATPSGPH    351 - 420
SNRTPSLQEVKIQRIGILQQLLRQEVEGLVGGQCVPLNGGSSLDMVELQPLLTEISRTLNATEHNSGTSH    421 - 490
LPGLLKHSGLPKPCLPEECGEPQPCPPAEPGPPEAFCRSEPEIPEPSLQEQLEVPEPYPPAEPRPLESCC    491 - 560
RSEPEIPESSRQEQLEVPEPCPPAEPRPLESYCRIEPEIPESSRQEQLEVPEPCPPAEPGPLQPSTQGQS    561 - 630
GPPGPCPRVELGASEPCTLEHRSLESSLPPCCSQWAPATTSLIFSSQHPLCASPPICSLQSLRPPAGQAG    631 - 700
LSNLAPRTLALRERLKSCLTAIHCFHEARLDDECAFYTSRAPPSGPTRVCTNPVATLLEWQDALCFIPVG    701 - 770
SAAPQGSP                                                                  771 - 778
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19060904 2009 An empirical framework for binary interactome mapping.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18218922 2008 Tastin is required for bipolar spindle assembly and centrosome integrity during mitosis.
More...