Property Summary

NCBI Gene PubMed Count 123
PubMed Score 162.56
PubTator Score 121.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 2.2
Amyotrophic lateral sclerosis 451 0.0 1.7

Expression

  Differential Expression (35)

Disease log2 FC p
acute quadriplegic myopathy 2.149 1.3e-05
adrenocortical carcinoma -2.164 1.9e-02
aldosterone-producing adenoma -1.065 4.1e-02
astrocytoma 1.600 2.0e-08
Atopic dermatitis -1.500 4.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.872 1.5e-03
Becker muscular dystrophy 1.383 3.4e-03
Breast cancer -2.400 3.5e-06
breast carcinoma -1.800 1.0e-04
dermatomyositis 1.900 1.9e-02
Down syndrome 1.800 1.0e-02
Duchenne muscular dystrophy 2.316 1.0e-08
ductal carcinoma in situ -1.100 7.2e-04
ependymoma 1.300 4.9e-02
fascioscapulohumeral muscular dystrophy 1.849 5.5e-05
glioblastoma 3.300 2.2e-03
group 3 medulloblastoma -1.900 2.3e-02
intraductal papillary-mucinous adenoma (... -3.800 7.1e-04
intraductal papillary-mucinous carcinoma... -5.000 4.6e-04
intraductal papillary-mucinous neoplasm ... -4.000 2.3e-02
invasive ductal carcinoma -1.104 2.0e-02
juvenile dermatomyositis 1.880 3.3e-09
limb girdle muscular dystrophy 2A 1.941 1.5e-05
lung adenocarcinoma -1.300 4.7e-08
lung cancer -1.200 2.5e-04
lung carcinoma -3.900 1.3e-34
medulloblastoma, large-cell -2.600 1.7e-03
non-small cell lung cancer -1.556 1.1e-14
oligodendroglioma 1.100 3.1e-04
ovarian cancer -7.300 6.5e-11
pancreatic cancer 1.600 4.5e-03
pituitary cancer -4.600 6.9e-13
primary pancreatic ductal adenocarcinoma 1.592 3.3e-03
psoriasis -1.500 1.0e-04
ulcerative colitis 1.400 1.9e-02

 CSPA Cell Line (1)

Gene RIF (88)

AA Sequence

MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLC      1 - 70
LPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVASAAAVAGPEMQTGRNNFVIR     71 - 140
RNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRGE    141 - 210
QCVDIDECTIPPYCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCN    211 - 280
QGYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMC    281 - 350
WNYHGGFRCYPRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA    351 - 420
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSVLRLTIIVGP    421 - 490
FSF                                                                       491 - 493
//

Text Mined References (126)

PMID Year Title