Property Summary

NCBI Gene PubMed Count 66
PubMed Score 291.71
PubTator Score 96.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.7
Large intestine cancer 126 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.4
interstitial lung disease 298 0.0 1.4
Disease Target Count Z-score Confidence
Cancer 2499 3.562 1.8
Disease Target Count Z-score Confidence
Relapsing fever 14 3.971 2.0

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 1.400 6.6e-03
astrocytic glioma 1.300 1.1e-03
Astrocytoma, Pilocytic 1.400 1.8e-04
atypical teratoid / rhabdoid tumor 2.200 9.2e-06
ependymoma 1.400 1.8e-03
Gaucher disease type 1 -1.200 1.8e-02
glioblastoma 2.500 1.7e-06
intraductal papillary-mucinous adenoma (... 1.500 2.4e-03
lung adenocarcinoma -1.700 3.2e-14
lung cancer -1.400 3.1e-04
lung carcinoma -1.300 3.6e-23
medulloblastoma 1.500 2.9e-03
medulloblastoma, large-cell 1.700 3.3e-03
non-small cell lung cancer -1.029 7.0e-10
oligodendroglioma 1.100 1.8e-03
osteosarcoma -1.882 1.1e-05
ovarian cancer -1.800 2.2e-10
pancreatic cancer 1.400 2.5e-03
pancreatic ductal adenocarcinoma liver m... 2.132 4.2e-03
Pick disease 1.400 3.0e-05
pituitary cancer -1.400 2.0e-02
primitive neuroectodermal tumor 1.700 3.6e-03
progressive supranuclear palsy 1.100 3.4e-02
psoriasis -3.100 3.9e-04
Rheumatoid arthritis 1.800 3.1e-04
subependymal giant cell astrocytoma 1.572 1.6e-02

Protein-protein Interaction (2)

Gene RIF (37)

AA Sequence

MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKV      1 - 70
QLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLDQSGPPSGDVNSLDKKLVLAF     71 - 140
RHLKLPTEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLTWFLLQKPGGRGALSIHNQEGATPVSLALER    141 - 210
GYHKLHQLLTEENAGEPDSWSSLSYEIPYGDCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLM    211 - 280
NIQQQLMKTNLKQMDSLMPLMMTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEETESTQCCPGSPVAQT    281 - 350
ESPCDLSSIVEEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQSLPDCGVKGTEGLSSCGN    351 - 420
RNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAGEMEHGLMNPD    421 - 490
ATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAASSLDGNKPAESSLAFSNEET    491 - 560
STEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDGLEPYTLLAAGIGEAMSPSDLALLGLEEDVM    561 - 630
PHQNSETNSSHAQSQKGKSSPICSTTGDDKLCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSS    631 - 700
QDPPDASHCEDPQAHTVTSDPVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKME    701 - 770
KELVPDQAVISDSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPL    771 - 840
EDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAIPEALNIKGNTDSSLQSVGKATLALDSVLTE    841 - 910
EGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDTQQFHEKSISADCAKDKALQL    911 - 980
SNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPPGASLATESRQEALGAEHNSSALLPCLLPDG    981 - 1050
SDGSDALNCSQPSPLDVGVKNTQSQGKTSACEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNV   1051 - 1120
LLSQEKNAVLGLPVALQDKAVTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQP   1121 - 1190
VAKELPTDMELSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVI   1191 - 1260
EQVKAAGALLTEGEACHMSLSSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATGSLAGCFAGRE   1261 - 1330
EPEKIILPVQGPEPAAEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMKQGPMTQAINRENWCTIEPCP   1331 - 1400
DAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSDSDLFHSPSDDMDSIIFPKPEEEHLACDITG   1401 - 1470
SSSSTDDTASLDRHSSHGSDVSLSQILKPNRSRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDS   1471 - 1540
ITEVPANCSVLRSSMRSLSPFRRHSWGPGKNAASDAEMNHRSSMRVLGDVVRRPPIHRRSFSLEGLTGGA   1541 - 1610
GVGNKPSSSLEVSSANAEELRHPFSGEERVDSLVSLSEEDLESDQREHRMFDQQICHRSKQQGFNYCTSA   1611 - 1680
ISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYNFLPHSPSKKDSEWKSGTKVSRTFS   1681 - 1750
YIKNKMSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSSIPVVGPISCSQCMKPFTNKDAYTC   1751 - 1820
ANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTSSLPTVIMRNKPSQPKERPRSAVLLVDETATTPIF   1821 - 1890
ANRRSQQSVSLSKSVSIQNITGVGNDENMSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQL   1891 - 1960
LGDFEIESKQLEAESWSRIIDSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLF   1961 - 2030
EQQMVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKTYGKF   2031 - 2100
CGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVLFQRILQCTKDNEVE   2101 - 2170
QEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGSVFL   2171 - 2240
KNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMTDPEM   2241 - 2310
VEVHASSKEERNSWIQIIQDTINTLNRDEDEGIPSENEEEKKMLDTRARELKEQLHQKDQKILLLLEEKE   2311 - 2380
MIFRDMAECSTPLPEDCSPTHSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSP   2381 - 2450
IEQDVVGPVSLPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKRNSEQ   2451 - 2520
VVQSVVHLYELLSALQGVVLQQDSYIEDQKLVLSERALTRSLSRPSSLIEQEKQRSLEKQRQDLANLQKQ   2521 - 2590
QAQYLEEKRRREREWEARERELREREALLAQREEEVQQGQQDLEKEREELQQKKGTYQYDLERLRAAQKQ   2591 - 2660
LEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMRIPSFFPSPEEPPSPSAPSIAKSGSLDSELSVSPK   2661 - 2730
RNSISRTHKDKGPFHILSSTSQTNKGPEGQSQAPASTSASTRLFGLTKPKEKKEKKKKNKTSRSQPGDGP   2731 - 2800
ASEVSAEGEEIFC                                                            2801 - 2813
//

Text Mined References (78)

PMID Year Title