Property Summary

NCBI Gene PubMed Count 52
PubMed Score 285.50
PubTator Score 64.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.600 1.4e-04
malignant mesothelioma -2.000 1.4e-07
ovarian cancer 1.300 2.0e-05

Gene RIF (32)

AA Sequence

MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDNENKILPFQYV      1 - 70
LCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRVVFHDRRLQYTEHQQLEGW     71 - 140
RWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPAKRTSVFIQVHCISTEFTMRKHGGEKGVPFR    141 - 210
VQIDTFKENENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTPHEKEKYQPSYETTILTECSPW    211 - 280
PEITYVNNSPSPGFNSSHSSFSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFT    281 - 350
NFSGADLLKLTRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDS    351 - 420
NGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMK    421 - 490
AETNDSYHIILK                                                              491 - 502
//

Text Mined References (55)

PMID Year Title