Property Summary

NCBI Gene PubMed Count 46
Grant Count 65
R01 Count 28
Funding $6,195,156.3
PubMed Score 263.45
PubTator Score 64.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
lung cancer 1.600 0.000
ovarian cancer 1.300 0.000

Synonym

Accession Q12800 A8K5E9 Q12801 Q9UD75 Q9UD77
Symbols LSF
SEF
LBP1C
LSF1D
TFCP2C

Gene

PANTHER Protein Class (1)

Gene RIF (31)

PMID Text
26723877 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1 pathway.
25731772 YY1 and LSF transcription factors cooperatively recruit histone deacetylase 1 (HDAC1) to the HIV-1 LTR promoter, thereby inhibiting transcription and Tat activation of the promoter
25337247 LSF is an important mediator in colorectal carcinoma tumorigenesis and progression, and LSF expression is an important index for and prognostic prediction.
22396589 Antiproliferative small-molecule inhibitors of transcription factor LSF reveal oncogene addiction to LSF in hepatocellular carcinoma
22167195 Inhibition of MMP-9 significantly abrogated LSF-induced angiogenesis as well as in vivo tumorigenesis, thus reinforcing the role of MMP-9 in facilitating LSF function.
21876634 Data suggest that LSF is a key mediator of the Notch1 signaling pathway, suggesting that it might be a novel therapeutic target for the treatment of hepatocellular carcinoma.
21703197 Secreted OPN, induced by LSF, activates c-Met via a potential interaction between OPN and its cell surface receptor CD44. A significant correlation was observed among LSF, OPN, and activated c-Met levels in HCC.
20661472 Study show that CRTR-1 is generally an activator of transcription and that it modulates the activity of other family members, CP2, NF2d9 and altNF2d9, in a cell specific manner.
20404171 The expression of osteopontin (OPN), a gene regulating every step in tumor progression and metastasis, was robustly up-regulated by LSF.
19902333 SRY is a hybrid of DGCR8 and SOX3, and is regulated by the transcription factor CP2.
More...

AA Sequence

MAWALKLPLADEVIESGLVQDFDASLSGIGQELGAGAYSMSDVLALPIFKQEESSLPPDNENKILPFQYV      1 - 70
LCAATSPAVKLHDETLTYLNQGQSYEIRMLDNRKLGELPEINGKLVKSIFRVVFHDRRLQYTEHQQLEGW     71 - 140
RWNRPGDRILDIDIPMSVGIIDPRANPTQLNTVEFLWDPAKRTSVFIQVHCISTEFTMRKHGGEKGVPFR    141 - 210
VQIDTFKENENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTPHEKEKYQPSYETTILTECSPW    211 - 280
PEITYVNNSPSPGFNSSHSSFSLGEGNGSPNHQPEPPPPVTDNLLPTTTPQEAQQWLHRNRFSTFTRLFT    281 - 350
NFSGADLLKLTRDDVIQICGPADGIRLFNALKGRMVRPRLTIYVCQESLQLREQQQQQQQQQQKHEDGDS    351 - 420
NGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMK    421 - 490
AETNDSYHIILK                                                              491 - 502
//

Text Mined References (49)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26723877 2016 Complement proteins C7 and CFH control the stemness of liver cancer cells via LSF-1.
25416956 2014 A proteome-scale map of the human interactome network.
25337247 2014 LSF expression and its prognostic implication in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22396589 2012 Antiproliferative small-molecule inhibitors of transcription factor LSF reveal oncogene addiction to LSF in hepatocellular carcinoma.
22167195 2012 Late SV40 factor (LSF) enhances angiogenesis by transcriptionally up-regulating matrix metalloproteinase-9 (MMP-9).
21876634 2011 Late SV40 factor: a key mediator of Notch signaling in human hepatocarcinogenesis.
21703197 2011 c-Met activation through a novel pathway involving osteopontin mediates oncogenesis by the transcription factor LSF.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...