Property Summary

NCBI Gene PubMed Count 4
PubMed Score 12.59
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
spina bifida 1074 3.196 1.6

AA Sequence

MLEGQLEAGEPKEGTHPEDPCPGAGAAMEKTPAAAEVPREDSNAGEMPSLQQQITSLHQELGRQQSLWAD      1 - 70
IHRKLQSHMDALRKQNRELREELRGLQRQQWEAGKKPAASPHAGRESHTLALEPAFGKISHLSADEDTTP     71 - 140
KYAGRKSQSATLLGQRWSSNHLAPPKPMSLKTERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAE    141 - 210
RRGVSEDGKIMHPSSRSPQNSGGRKSPVQASQATTLQEQTAAARGADRSSSVLGSSEGGFLSRVQADEFA    211 - 280
SSAPDSAERQNLPVNPPSSLEIAQAMDTKMKKEEVQEEKRHPKGKADDCRRSGFPSEFPGALHAAPSRQD    281 - 350
MGP                                                                       351 - 353
//

Text Mined References (5)

PMID Year Title