Property Summary

NCBI Gene PubMed Count 46
PubMed Score 505.42
PubTator Score 176.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (38)

Disease log2 FC p
active Crohn's disease 1.143 6.3e-03
active ulcerative colitis 1.107 5.7e-03
acute quadriplegic myopathy 1.382 8.7e-07
adrenocortical carcinoma 1.086 2.4e-02
aldosterone-producing adenoma -1.260 4.0e-02
Atopic dermatitis -1.200 2.0e-04
atypical teratoid / rhabdoid tumor 1.400 7.7e-04
autosomal dominant Emery-Dreifuss muscul... 1.813 1.9e-03
Breast cancer 2.600 2.5e-02
breast carcinoma -1.100 1.8e-02
dermatomyositis 1.800 1.4e-03
Down syndrome 1.300 1.3e-03
Duchenne muscular dystrophy 1.073 7.1e-05
ductal carcinoma in situ -1.200 8.2e-03
ependymoma 1.100 1.4e-04
fascioscapulohumeral muscular dystrophy 1.261 3.3e-05
Gaucher disease type 1 -2.900 2.2e-02
glioblastoma 1.400 8.6e-03
group 3 medulloblastoma -1.100 1.2e-02
intraductal papillary-mucinous adenoma (... 2.100 3.3e-04
intraductal papillary-mucinous carcinoma... 2.400 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.6e-02
invasive ductal carcinoma -2.000 1.5e-02
juvenile dermatomyositis 1.232 2.3e-09
lung adenocarcinoma 1.379 4.2e-03
lung cancer 1.200 2.6e-03
medulloblastoma, large-cell 1.500 1.7e-06
non primary Sjogren syndrome sicca 1.100 3.4e-02
osteosarcoma 2.183 8.4e-04
ovarian cancer -1.500 5.1e-03
pancreatic cancer 1.200 4.7e-04
Pick disease -1.100 6.2e-03
primary pancreatic ductal adenocarcinoma 1.224 4.8e-02
primitive neuroectodermal tumor -1.200 1.4e-02
progressive supranuclear palsy -1.100 2.1e-02
psoriasis -1.100 2.7e-06
Rheumatoid arthritis 1.900 5.1e-03
tuberculosis -1.200 1.0e-03

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (21)

AA Sequence

MAQRKNAKSSGNSSSSGSGSGSTSAGSSSPGARRETKHGGHKNGRKGGLSGTSFFTWFMVIALLGVWTSV      1 - 70
AVVWFDLVDYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEP     71 - 140
QNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEH    141 - 210
SYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVT    211 - 280
APPEDNPVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEK    281 - 350
LRKRGKIEEAVNAFKELVRKYPQSPRARYGKAQCEDDLAEKRRSNEVLRGAIETYQEVASLPDVPADLLK    351 - 420
LSLKRRSDRQQFLGHMRGSLLTLQRLVQLFPNDTSLKNDLGVGYLLIGDNDNAKKVYEEVLSVTPNDGFA    421 - 490
KVHYGFILKAQNKIAESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVW    491 - 560
QRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDEGLAVMDKAKGLFLPEDENLREKGDWSQFTL    561 - 630
WQQGRRNENACKGAPKTCTLLEKFPETTGCRRGQIKYSIMHPGTHVWPHTGPTNCRLRMHLGLVIPKEGC    631 - 700
KIRCANETKTWEEGKVLIFDDSFEHEVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI                701 - 758
//

Text Mined References (54)

PMID Year Title