Property Summary

NCBI Gene PubMed Count 12
PubMed Score 108.32
PubTator Score 77.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Bipolar Disorder 1.281 3.6e-02
Breast cancer -1.100 3.5e-13
intraductal papillary-mucinous neoplasm ... -1.800 6.4e-05
lung cancer -1.600 3.3e-05
malignant mesothelioma -1.100 6.0e-06
ovarian cancer -1.500 4.0e-07
pancreatic ductal adenocarcinoma liver m... -1.060 7.2e-03

Gene RIF (5)

AA Sequence

MTVVSVPQREPLVLGGRLAPLGFSSRGYFGALPMVTTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTP      1 - 70
QPRAPAALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEV     71 - 140
PGPAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPK    141 - 210
INRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYA    211 - 280
GAKFSDPPSPSVLPKPPSHWMGSTVENSNQNRELMAVHLKTLLKVQT                           281 - 327
//

Text Mined References (13)

PMID Year Title