Property Summary

NCBI Gene PubMed Count 12
Grant Count 11
R01 Count 2
Funding $1,269,323.02
PubMed Score 103.23
PubTator Score 77.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (5)

PMID Text
19334528 RFX1 specifically bind to promoter region and negatively regulate the transcription of the human PNRC gene.
18703122 Three human PNRC splicing variants designated PNRC1c, PNRC1d and PNRC1f, are identified.
18281297 Functional analysis of the 5' flanking region of the human PNRC gene by deletion mutagenesis, transient transfection and luciferase assays revealed that the -123/+27 region is the minimal promoter of the human PNRC gene.
18187620 Knockdown of proline-rich nuclear receptor coactivator 1 (PNRC1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15122321 PNRC and Grb2, by interacting with each other, can suppress nuclear receptor-mediated regulation and growth factor-mediated regulation in human breast tissue

AA Sequence

MTVVSVPQREPLVLGGRLAPLGFSSRGYFGALPMVTTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTP      1 - 70
QPRAPAALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEV     71 - 140
PGPAAALAPSPAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPK    141 - 210
INRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYA    211 - 280
GAKFSDPPSPSVLPKPPSHWMGSTVENSNQNRELMAVHLKTLLKVQT                           281 - 327
//

Text Mined References (13)

PMID Year Title
19334528 [Transcriptional regulation of the human gene coding for proline-rich nuclear receptor coactivator (pnrc) by regulatory factor x (rfx1)].
18703122 2008 Identification and characterization of PNRC splicing variants.
18281297 2008 Transcriptional regulation of the human PNRC promoter by NFY in HepG2 cells.
17612402 2007 PNRC is a unique nuclear receptor coactivator that stimulates RNA polymerase III-dependent transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15122321 2004 A novel crosstalk mechanism between nuclear receptor-mediated and growth factor/Ras-mediated pathways through PNRC-Grb2 interaction.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11574675 2001 PNRC2 is a 16 kDa coactivator that interacts with nuclear receptors through an SH3-binding motif.
More...