Property Summary

NCBI Gene PubMed Count 459
PubMed Score 1143.26
PubTator Score 667.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Corneal disease 31 0.0 3.0
Glaucoma 239 0.0 3.0
Rheumatoid arthritis 1191 0.0 0.9
Disease Target Count Z-score Confidence
Cancer 2499 5.242 2.6
Disease Target Count
Alveolar rhabdomyosarcoma 7

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.959 2.6e-06
Breast cancer -1.500 4.6e-14
breast carcinoma -1.600 1.2e-05
dermatomyositis 1.200 8.2e-03
ductal carcinoma in situ -1.700 1.8e-04
Endometriosis -1.151 3.0e-02
ependymoma 1.300 2.3e-02
fibroadenoma -1.400 2.0e-02
group 3 medulloblastoma -1.600 9.6e-03
intraductal papillary-mucinous carcinoma... -1.300 1.2e-02
invasive ductal carcinoma -1.900 2.6e-04
lung adenocarcinoma -1.500 6.3e-20
lung cancer -1.100 1.0e-02
malignant mesothelioma -2.700 9.1e-09
medulloblastoma, large-cell -1.800 7.6e-05
osteosarcoma -2.156 3.6e-03
ovarian cancer -1.200 8.2e-05
Pick disease 1.300 8.5e-04
pituitary cancer -1.600 1.1e-02
psoriasis -1.200 4.0e-05
tuberculosis -1.200 1.8e-05

Gene RIF (427)

AA Sequence

MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADF      1 - 70
MSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPA     71 - 140
AAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWK    141 - 210
NSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSG    211 - 280
QEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPP    281 - 350
SAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN    351 - 420
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSR    421 - 490
VLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKT    491 - 560
PVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDF    561 - 630
NFDNVLPNQSFPHSVKTTTHSWVSG                                                 631 - 655
//

Text Mined References (469)

PMID Year Title