Property Summary

NCBI Gene PubMed Count 407
PubMed Score 1000.82
PubTator Score 667.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
Breast cancer 3099 5.33783792582373E-23
lung adenocarcinoma 2714 6.34541716548328E-20
malignant mesothelioma 3163 9.08400299359392E-9
ovarian cancer 8492 1.07438539583539E-6
medulloblastoma, large-cell 6234 1.8832134211817E-6
acute quadriplegic myopathy 1157 2.56956887108889E-6
breast carcinoma 1614 1.18421334862928E-5
tuberculosis 1563 1.7993294038574E-5
psoriasis 6685 2.13770804315835E-5
invasive ductal carcinoma 2950 2.61402628465004E-4
group 3 medulloblastoma 2254 2.79885033353962E-4
lung cancer 4473 3.28063463190815E-4
pituitary cancer 1972 3.50601507827624E-4
ductal carcinoma in situ 1745 3.54919719522826E-4
Pick disease 1893 8.50421421562453E-4
osteosarcoma 7933 0.00358971382485089
dermatomyositis 967 0.0081556520379862
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0122724600221839
fibroadenoma 557 0.0203381143710732
ependymoma 2514 0.0227318909544429
Endometriosis 535 0.0302767174134302
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 2.0
Glaucoma 135 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 5.142 2.6
Disease Target Count
Alveolar rhabdomyosarcoma 7
Disease Target Count
Rhabdomyosarcoma 2 3

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
ependymoma 1.300 0.023
psoriasis 1.800 0.000
osteosarcoma -2.156 0.004
group 3 medulloblastoma -1.800 0.000
medulloblastoma, large-cell -2.700 0.000
acute quadriplegic myopathy 1.959 0.000
tuberculosis -1.200 0.000
intraductal papillary-mucinous carcinoma... -1.300 0.012
lung cancer -1.400 0.000
breast carcinoma -1.600 0.000
fibroadenoma -1.400 0.020
lung adenocarcinoma -1.500 0.000
Endometriosis -1.151 0.030
Pick disease 1.300 0.001
Breast cancer -2.000 0.000
ductal carcinoma in situ -2.000 0.000
invasive ductal carcinoma -2.300 0.000
ovarian cancer -1.800 0.000
pituitary cancer -2.000 0.000
dermatomyositis 1.200 0.008

Synonym

Accession Q12778 O43523 Q5VYC7 Q6NSK6
Symbols FKH1
FKHR
FOXO1A

Gene

PDB

3CO6   3CO7   3COA   4LG0   5DUI  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (376)

PMID Text
27529982 FOXO1A gene polymorphic site rs4943794 is associated with an acquisition of old and senescent age and with women's longevity. FOXO3A gene polymorphic site rs3800231 is associated with longevity in both women and men.
27095304 miR-3188 regulates nasopharyngeal carcinoma proliferation and chemosensitivity through a FOXO1-modulated positive feedback loop with mTOR-p-PI3K/AKT-c-JUN.
26929406 Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Binding of Transcriptional Regulators at Insulin-sensitive Genes.
26735015 findings identify FOXO1 as a critical rheostat of vascular expansion and define the FOXO1-MYC transcriptional network as a novel metabolic checkpoint during endothelial growth and proliferation
26727107 Foxo1 and PDX1 are colocalized in fetal pancreatic islets, suggesting they function in parallel in beta cells.
26620759 we show that FOXO1 transcription factor expression was restricted to the germinal center dark zone and was required for dark zone formation
26617698 the expression of FOXO1 had an inverse correlation with expression of miR-96 in papillary thyroid carcinoma specimens by RT-qPCR and western blot analysis
26593208 An oncogenic miR-9 targeted FoxO1 to promote cell growth; downregulation of this axis was involved in erlotinib's cancer cells growth inhibitory effects.
26591102 Under the influence of limited access to food FoxO proteins are activated. (review)
26585955 In primary Diffuse large B-cell lymphomas, FOXO1 expression was present in 80% of tumors, correlated with SYK activity, and was associated with longer overall survival.
More...

AA Sequence

MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADF      1 - 70
MSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPA     71 - 140
AAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWK    141 - 210
NSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSG    211 - 280
QEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPP    281 - 350
SAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN    351 - 420
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSR    421 - 490
VLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKT    491 - 560
PVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDF    561 - 630
NFDNVLPNQSFPHSVKTTTHSWVSG                                                 631 - 655
//

Text Mined References (417)

PMID Year Title
27529982 2016 [Analysis of FOXO1A and FOXO3A Gene Allele Association with Human Longevity].
27095304 2016 miR-3188 regulates nasopharyngeal carcinoma proliferation and chemosensitivity through a FOXO1-modulated positive feedback loop with mTOR-p-PI3K/AKT-c-JUN.
26929406 2016 Loss of Interdependent Binding by the FoxO1 and FoxA1/A2 Forkhead Transcription Factors Culminates in Perturbation of Active Chromatin Marks and Binding of Transcriptional Regulators at Insulin-sensitive Genes.
26735015 2016 FOXO1 couples metabolic activity and growth state in the vascular endothelium.
26727107 2016 FoxO1 Plays an Important Role in Regulating ?-Cell Compensation for Insulin Resistance in Male Mice.
26620759 2015 The FOXO1 Transcription Factor Instructs the Germinal Center Dark Zone Program.
26617698 2015 MicroRNA-96 plays an oncogenic role by targeting FOXO1 and regulating AKT/FOXO1/Bim pathway in papillary thyroid carcinoma cells.
26593208 2015 Oncogenic miR-9 is a target of erlotinib in NSCLCs.
26591102 2014 [MOLECULAR MECHANISM OF A CALORIC RESTRICTION DIET].
26585955 2016 FOXO1 activation is an effector of SYK and AKT inhibition in tonic BCR signal-dependent diffuse large B-cell lymphomas.
More...