Property Summary

NCBI Gene PubMed Count 155
Grant Count 87
R01 Count 54
Funding $7,201,542.21
PubMed Score 331.26
PubTator Score 199.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.358 0.000
medulloblastoma, large-cell 1.600 0.000

Synonym

Accession Q12772 Q05BD5 Q6GTH7 Q86V36 Q9UH04 SREBP-2
Symbols SREBP2
bHLHd2
SREBP-2

Gene

PDB

1UKL  

Gene RIF (123)

PMID Text
26855332 Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation.
26728456 knockdown of endogenous SREBP2 in HepG2 cells lowered ACSL1 mRNA and protein levels.
26698881 Data suggest that Hepacivirus (HCV) activates hepatocyte NLRP3 inflammasomes, induces lipogenic enzymes/lipid droplet formation, and up-regulates transport of SREBF1/SREBF2/SCAP from ER to Golgi where SREBPs undergo proteolytic activation by S1P/S2P.
26535009 The connections of EGFR and ERBB4 signaling with SREBP-2-regulated cholesterol metabolism are likely to be important in ERBB-regulated developmental processes and may contribute to metabolic remodeling in ERBB-driven cancers.
26512780 Data show that mutant p53 protein activates the sterol regulatory element-binding proteins SREBP-1 and SREBP-2-mediated signaling pathways in prostate cancer (PCa) cells.
26321664 performed a detailed promoter/enhancer analysis of ELOVL5 gene, and identified two new SREBP binding sites, one in the 10 kb upstream region and one in the exon 1
26302339 the results of the present study showed that luteolin modulates HMGCR transcription by decreasing the expression and nuclear translocation of SREBP-2.
26028026 mTORC1/SREBP pathway is a major mechanism through which common oncogenic signaling events induce de novo lipid synthesis to promote aberrant growth and proliferation of cancer cells
25998247 Data suggest lysophosphatidylcholine (LPC) up-regulates SREBP-2 and cholesterol efflux in vascular endothelium; 25-hydroxycholesterol (25-HC) inhibits these effects of LPC; both LPC and 25-HC up-regulate release of interleukin-6 and interleukin-8.
25933205 the 5-aminoimidazole-4-carboxyamide ribonucleoside (AICAR)-induced activation of AMPK directly inhibited the expression of SREBP-2 and HMGCR and HMGCS, and suppressed the TSH-stimulated up-regulation of SREBP-2 in HepG2 cells.
More...

AA Sequence

MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGSGSSSGSSGSS      1 - 70
SSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTSVPTTPRATPILQPRPQPQPQ     71 - 140
PQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQR    141 - 210
VLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTP    211 - 280
IQTAALQVPTLVGSSGTILTTMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKI    281 - 350
IELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK    351 - 420
IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFL    421 - 490
CLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNGVIVLSVFVKLLVHG    491 - 560
EPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTCLAVLGRALPTSRLDLACSLSWNVIRYSLQK    561 - 630
LRLVRWLLKKVFQCRRATPATEAGFEDEAKTSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNL    631 - 700
AECAEEKIPPSTLVEIHLTAAMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFF    701 - 770
MERSWSVKSAAKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEY    771 - 840
LKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFTKVERIPKALE    841 - 910
VTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSGATSDPALNHVVQLLTCDLLL    911 - 980
SLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRRLAHSFRPAYRKVFLHEATVRLMAGASPTRT    981 - 1050
HQLLEHSLRRRTTQSTKHGEVDAWPGQRERATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRR   1051 - 1120
SCNDCQQMIVKLGGGTAIAAS                                                    1121 - 1141
//

Text Mined References (159)

PMID Year Title
26855332 2016 PI3K-Akt signaling pathway upregulates hepatitis C virus RNA translation through the activation of SREBPs.
26728456 2016 SREBP2 Activation Induces Hepatic Long-chain Acyl-CoA Synthetase 1 (ACSL1) Expression in Vivo and in Vitro through a Sterol Regulatory Element (SRE) Motif of the ACSL1 C-promoter.
26698881 2016 The Hepatitis C Virus-induced NLRP3 Inflammasome Activates the Sterol Regulatory Element-binding Protein (SREBP) and Regulates Lipid Metabolism.
26535009 2015 Neuregulin-activated ERBB4 induces the SREBP-2 cholesterol biosynthetic pathway and increases low-density lipoprotein uptake.
26512780 2015 Anti-cancer efficacy of SREBP inhibitor, alone or in combination with docetaxel, in prostate cancer harboring p53 mutations.
26321664 2015 Identification of human ELOVL5 enhancer regions controlled by SREBP.
26302339 2015 The Flavone Luteolin Suppresses SREBP-2 Expression and Post-Translational Activation in Hepatic Cells.
26028026 2016 Oncogenic PI3K and K-Ras stimulate de novo lipid synthesis through mTORC1 and SREBP.
25998247 2015 Lysophosphatidylcholine promotes SREBP-2 activation via rapid cholesterol efflux and SREBP-2-independent cytokine release in human endothelial cells.
25933205 2015 AICAR-Induced Activation of AMPK Inhibits TSH/SREBP-2/HMGCR Pathway in Liver.
More...