Property Summary

NCBI Gene PubMed Count 43
Grant Count 77
R01 Count 29
Funding $12,054,994.79
PubMed Score 71.18
PubTator Score 118.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q12770 Q8N2E0 Q8WUA1 SCAP
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (23)

PMID Text
26555173 Data indicate that glucose-mediated glycosylation promotes SREBP cleavage-activating protein (SCAP) trafficking to the Golgi Leading to sterol regulatory element binding protein 1 (SREBP-1) activation.
25028659 identified interaction of three genes in INSIG-SCAP-SREBP pathway on risk of obesity, revealing that these genes affect obesity more likely through a complex interaction pattern than single gene effect.
24478315 SREBP cleavage regulates Golgi-to-endoplasmic reticulum recycling of SREBP cleavage-activating protein (SCAP)
24371177 SCAP gene polymorphisms decrease the risk of nonalcoholic fatty liver disease in females with metabolic syndrome.
24146768 Enhanced SCAP glycosylation by inflammation induces macrophage foam cell formation.
23564452 A point mutation in Scap Loop 7 prevents interaction with Loop 1 and abolishes endoplasmic reticulum exit.
23454642 Data indicate that SREBP-2 and Scap are regulated by factors driving prostate growth, and suggest exploring this observation further could shed light on prostate carcinogenesis.
23440422 the SCAP/SREBP signaling axis has a role in protecting cancer cells from lipotoxicity
20186155 Observational study of gene-disease association. (HuGE Navigator)
20111910 could not identify any association between SREBF-2 1784G > C or SCAP 2386A > G SNPs and premature coronary artery disease or extent of coronary lesions in a Chinese population.
More...

AA Sequence

MTLTERLREKISRAFYNHGLLCASYPIPIILFTGFCILACCYPLLKLPLPGTGPVEFTTPVKDYSPPPVD      1 - 70
SDRKQGEPTEQPEWYVGAPVAYVQQIFVKSSVFPWHKNLLAVDVFRSPLSRAFQLVEEIRNHVLRDSSGI     71 - 140
RSLEELCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQNDWERFHADPDIIGTIHQHEPKTLQTSATLK    141 - 210
DLLFGVPGKYSGVSLYTRKRMVSYTITLVFQHYHAKFLGSLRARLMLLHPSPNCSLRAESLVHVHFKEEI    211 - 280
GVAELIPLVTTYIILFAYIYFSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFP    281 - 350
YLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNMATELGIILIGYFTLVPAIQEFCLF    351 - 420
AVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPEACLPSAKPVGQPTRYERQLAVRPSTPHTITL    421 - 490
QPSSFRNLRLPKRLRVVYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLRNYLAAQVTEQSPLGEGALAP    491 - 560
MPVPSGMLPPSHPDPAFSIFPPDAPKLPENQTSPGESPERGGPAEVVHDSPVPEVTWGPEDEELWRKLSF    561 - 630
RHWPTLFSYYNITLAKRYISLLPVIPVTLRLNPREALEGRHPQDGRSAWPPPGPIPAGHWEAGPKGPGGV    631 - 700
QAHGDVTLYKVAALGLATGIVLVLLLLCLYRVLCPRNYGQLGGGPGRRRRGELPCDDYGYAPPETEIVPL    701 - 770
VLRGHLMDIECLASDGMLLVSCCLAGHVCVWDAQTGDCLTRIPRPGRQRRDSGVGSGLEAQESWERLSDG    771 - 840
GKAGPEEPGDSPPLRHRPRGPPPPSLFGDQPDLTCLIDTNFSAQPRSSQPTQPEPRHRAVCGRSRDSPGY    841 - 910
DFSCLVQRVYQEEGLAAVCTPALRPPSPGPVLSQAPEDEGGSPEKGSPSLAWAPSAEGSIWSLELQGNLI    911 - 980
VVGRSSGRLEVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSLDFFSLETHTALSPLQFRGTPG    981 - 1050
RGSSPASPVYSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSG   1051 - 1120
AITTVYIDQTMVLASGGQDGAICLWDVLTGSRVSHVFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTG   1121 - 1190
IKFYSIQQDLGCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVC   1191 - 1260
NFGSELSLVYVPSVLEKLD                                                      1261 - 1279
//

Text Mined References (48)

PMID Year Title
26555173 2015 Glucose-Mediated N-glycosylation of SCAP Is Essential for SREBP-1 Activation and Tumor Growth.
25028659 2014 The gene-gene interaction of INSIG-SCAP-SREBP pathway on the risk of obesity in Chinese children.
24478315 2014 Sterol regulatory element-binding protein (SREBP) cleavage regulates Golgi-to-endoplasmic reticulum recycling of SREBP cleavage-activating protein (SCAP).
24371177 2013 SCAP gene polymorphisms decrease the risk of nonalcoholic fatty liver disease in females with metabolic syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24146768 2013 Enhanced SCAP glycosylation by inflammation induces macrophage foam cell formation.
23564452 2013 Point mutation in luminal loop 7 of Scap protein blocks interaction with loop 1 and abolishes movement to Golgi.
23454642 2013 Overexpression of a key regulator of lipid homeostasis, Scap, promotes respiration in prostate cancer cells.
23440422 2013 An essential requirement for the SCAP/SREBP signaling axis to protect cancer cells from lipotoxicity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...