Property Summary

NCBI Gene PubMed Count 27
Grant Count 12
R01 Count 10
Funding $796,914.77
PubMed Score 12.81
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (11)

PMID Text
26527604 transcriptome sequencing of patient-derived angiosarcoma cells, identified a novel fusion gene NUP160-SLC43A3 found to be expressed in 9 of 25 human angiosarcoma specimens that were examined.
25904327 Nup107-160 complex and its partner Elys dynamically colocalize with Nup98 and CRM1 into endogenous GLFG bodies present in specific HeLa sublines.
22031293 The SUMO-specific isopeptidase SENP2 associates dynamically with nuclear pore complexes through interactions with karyopherins and the Nup107-160 nucleoporin subcomplex.
20974814 The interactions of Nup160 with Pom121 and are predicted to assist in the formation of the nuclear pore and the anchoring of the Nuclear pore complexes to the pore membrane.
20081840 Data show that Nup107-160 promotes spindle assembly through Ran-GTP-regulated nucleation of microtubules by gamma-TuRC at kinetochores, and reveal a relationship between nucleoporins and the microtubule cytoskeleton.
19864462 A major function of the Nup107 complex in mitosis is to ensure the proper localization of the chromosome passenger complex at the centromere.
19576787 Data show that structure-guided sequence comparison of Nup160 and Saccharomyces cerevisiae Nup120 strongly suggests that both proteins adopt the same unique fold despite a low sequence identity of 10%.
18187620 Knockdown of nucleoporin 160kDa (NUP160) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17363900 These data thus provide the first molecular clues underlying the function of the human Nup107-160 complex at kinetochores.
17360435 phosphorylation does not affect interactions within the Nup107-160 subcomplex, but regulates the association of the subcomplex with the NPC and other proteins
More...

AA Sequence

MLHLSAAPPAPPPEVTATARPCLCSVGRRGDGGKMAAAGALERSFVELSGAERERPRHFREFTVCSIGTA      1 - 70
NAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPG     71 - 140
GVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVDSQMQSIFTDIGKVDFTDPCNYQLIPAVPGI    141 - 210
SPNSTASTAWLSSDGEALFALPCASGGIFVLKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTAIRGDQS    211 - 280
PSDRPLSLAVHCVEHDAFIFALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDLRLTAGTGHKLRLAYSP    281 - 350
TMGLYLGIYMHAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTVVK    351 - 420
YINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFCRGTERNLDLS    421 - 490
WSELKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQEALSHPLALHLNPHTNMVCLL    491 - 560
KKGYLSFLIPSSLVDHLYLLPYENLLTEDETTISDDVDIARDVICLIKCLRLIEESVTVDMSVIMEMSCY    561 - 630
NLQSPEKAAEQILEDMITIDVENVMEDICSKLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPAQPLNIR    631 - 700
MNLTQLYGSNTAGYIVCRGVHKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLL    701 - 770
LSYYLIKWGSECLATDVPLDTLESNLQHLSVLELTDSGALMANRFVSSPQTIVELFFQEVARKHIISHLF    771 - 840
SQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCR    841 - 910
FMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVSTPRLQYYDKVLRLLDVIGLPELVI    911 - 980
QLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVLCERSQLQDL    981 - 1050
VEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEK   1051 - 1120
QGNCYLAALNCLRLIRPEYAWIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLA   1121 - 1190
RIRLTLAQHDPSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAA   1191 - 1260
QAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSHGVPLPNWLINSYK   1261 - 1330
KVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENS   1331 - 1400
ANSHNIALSQKILDKLEDYQQKVDKATRDLLYRRTL                                     1401 - 1436
//

Text Mined References (36)

PMID Year Title
26527604 2015 NUP160-SLC43A3 is a novel recurrent fusion oncogene in angiosarcoma.
25904327 2015 Intranuclear dynamics of the Nup107-160 complex.
25416956 2014 A proteome-scale map of the human interactome network.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22031293 2011 The SUMO-specific isopeptidase SENP2 associates dynamically with nuclear pore complexes through interactions with karyopherins and the Nup107-160 nucleoporin subcomplex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20974814 2010 Pom121 links two essential subcomplexes of the nuclear pore complex core to the membrane.
More...