Property Summary

NCBI Gene PubMed Count 27
PubMed Score 13.59
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 2.000 2.1e-04
aldosterone-producing adenoma -1.030 3.1e-02
astrocytic glioma 1.700 4.2e-02
Astrocytoma, Pilocytic 1.600 4.7e-06
atypical teratoid / rhabdoid tumor 2.300 1.2e-07
ependymoma 2.500 6.1e-03
glioblastoma 2.100 1.4e-10
group 3 medulloblastoma 2.100 1.3e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.3e-02
lung cancer 1.300 9.0e-04
medulloblastoma, large-cell 2.500 3.7e-05
oligodendroglioma 2.300 3.7e-03
osteosarcoma -2.205 3.6e-08
ovarian cancer -1.200 6.3e-03
primitive neuroectodermal tumor 2.700 6.5e-07
psoriasis -1.700 1.5e-04

Gene RIF (11)

AA Sequence

MLHLSAAPPAPPPEVTATARPCLCSVGRRGDGGKMAAAGALERSFVELSGAERERPRHFREFTVCSIGTA      1 - 70
NAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPG     71 - 140
GVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVDSQMQSIFTDIGKVDFTDPCNYQLIPAVPGI    141 - 210
SPNSTASTAWLSSDGEALFALPCASGGIFVLKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTAIRGDQS    211 - 280
PSDRPLSLAVHCVEHDAFIFALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDLRLTAGTGHKLRLAYSP    281 - 350
TMGLYLGIYMHAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTVVK    351 - 420
YINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFCRGTERNLDLS    421 - 490
WSELKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQEALSHPLALHLNPHTNMVCLL    491 - 560
KKGYLSFLIPSSLVDHLYLLPYENLLTEDETTISDDVDIARDVICLIKCLRLIEESVTVDMSVIMEMSCY    561 - 630
NLQSPEKAAEQILEDMITIDVENVMEDICSKLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPAQPLNIR    631 - 700
MNLTQLYGSNTAGYIVCRGVHKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLL    701 - 770
LSYYLIKWGSECLATDVPLDTLESNLQHLSVLELTDSGALMANRFVSSPQTIVELFFQEVARKHIISHLF    771 - 840
SQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCR    841 - 910
FMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVSTPRLQYYDKVLRLLDVIGLPELVI    911 - 980
QLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVLCERSQLQDL    981 - 1050
VEFPYVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEK   1051 - 1120
QGNCYLAALNCLRLIRPEYAWIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLA   1121 - 1190
RIRLTLAQHDPSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAA   1191 - 1260
QAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSHGVPLPNWLINSYK   1261 - 1330
KVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENS   1331 - 1400
ANSHNIALSQKILDKLEDYQQKVDKATRDLLYRRTL                                     1401 - 1436
//

Text Mined References (36)

PMID Year Title