Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.26
PubTator Score 21.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis 1.424 4.6e-03
acute myeloid leukemia -2.200 4.2e-02
atypical teratoid / rhabdoid tumor -1.100 3.6e-02
chronic kidney disease 1.100 2.0e-02
group 3 medulloblastoma -2.400 8.5e-06
intraductal papillary-mucinous carcinoma... -1.200 4.2e-02
lung cancer 1.500 6.4e-03
lung carcinoma 2.200 7.0e-32
medulloblastoma, large-cell -1.600 6.8e-03
Multiple myeloma 1.821 2.8e-04
nasopharyngeal carcinoma -1.300 8.9e-06
ovarian cancer -1.400 7.8e-05
pancreatic ductal adenocarcinoma liver m... 2.246 1.2e-02

Gene RIF (8)

AA Sequence

MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI      1 - 70
SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG     71 - 140
GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS    141 - 210
QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS    211 - 280
VLPQNRSSPCIHYFTGTPDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA    281 - 350
HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK          351 - 414
//

Text Mined References (23)

PMID Year Title