Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.35
PubTator Score 21.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25399950 Luciferase report assay showed that the rs6976789 variant T allele influenced the binding ability of miR-148a. Our results suggested that the SCRN1 rs6976789 polymorphism may play an important role in the GC development and progression
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21385630 in synovial sarcoma, metastasis-free survival was significantly higher in the group with high secernin-1 expression compared to low expression; results indicate secernin-1 may be used as a biomarker to predict overall and metastasis-free survival
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20039278 SCRN1 expression is a prognostic factor in colorectal cancer patients
12221138 Purified and identified bovine secernin, in addition to bioinformatics analysis of similar proteins in mouse, rat and human.

AA Sequence

MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI      1 - 70
SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG     71 - 140
GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS    141 - 210
QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS    211 - 280
VLPQNRSSPCIHYFTGTPDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA    281 - 350
HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK          351 - 414
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25399950 2014 A genetic variant of miR-148a binding site in the SCRN1 3'-UTR is associated with susceptibility and prognosis of gastric cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21385630 2011 Secernin-1 as a novel prognostic biomarker candidate of synovial sarcoma revealed by proteomics.
21269460 2011 Initial characterization of the human central proteome.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20039278 2010 SCRN1 is a novel marker for prognosis in colorectal cancer.
More...