Property Summary

NCBI Gene PubMed Count 40
PubMed Score 149.34
PubTator Score 133.47

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.427 1.8e-02
group 4 medulloblastoma -1.200 8.3e-04
interstitial cystitis -1.100 1.9e-04
ovarian cancer -1.100 2.3e-05
ulcerative colitis 1.100 2.4e-02

Protein-protein Interaction (8)

Gene RIF (24)

AA Sequence

MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFL      1 - 70
RLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINK     71 - 140
YDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRV    141 - 210
RKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAG    211 - 280
FGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF                     281 - 333
//

Text Mined References (41)

PMID Year Title