Property Summary

NCBI Gene PubMed Count 32
Grant Count 15
R01 Count 8
Funding $1,402,045.62
PubMed Score 60.17
PubTator Score 46.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (24)

PMID Text
26547933 ST3GAL1-associated transcriptomic program portends poor prognosis in glioma patients with higher tumor grades.ST3Gal1-regulated self-renewal traits are crucial to the sustenance of glioblastoma multiforme growth.
26436774 rs113350588 and rs1048479 may alter the function of ST3GAL1. The GC haplotype was associated with an increased risk of death in subjects with influenza. The AT haplotype was associated with an increased risk of severe disease and death.
25086069 Results show that ST3Gal1 uses GM130-GRASP65 and giantin, whereas C2GnT-L uses only giantin for Golgi targeting and defective giantin dimerization in PC-3 and DU145 prostate cancer cells causes fragmentation of the Golgi and prevents its targeting.
23990450 NMIIA is the master regulator of Golgi fragmentation induced by heat shock or inhibition/depletion of HSP70/90 through interaction with gylosyltransferases.
23549466 the high expression of ST3Gal I and ST6Gal I, in skin tumors, is associated with tumors with greater potential for invasion and metastasis, as in the case of squamous cell carcinoma, and this may be related to their behavior.
23275522 Induction of COX-2 in breast cancer cell line results in the increased expression of ST3Gal-I.
22534569 Down-regulation of ST3GalI is correlated with breast cancer
20534593 Over-expression of ST3Gal-I promotes mammary tumorigenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKL      1 - 70
SAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCR     71 - 140
RCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFK    141 - 210
TIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHV    211 - 280
CDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR              281 - 340
//

Text Mined References (32)

PMID Year Title
26547933 2016 ST3GAL1-Associated Transcriptomic Program in Glioblastoma Tumor Growth, Invasion, and Prognosis.
26436774 2015 Sia?2-3Gal?1- Receptor Genetic Variants Are Associated with Influenza A(H1N1)pdm09 Severity.
25086069 2014 Restoration of compact Golgi morphology in advanced prostate cancer enhances susceptibility to galectin-1-induced apoptosis by modifying mucin O-glycan synthesis.
24503447 2014 Genome-wide association study to characterize serum bilirubin elevations in patients with HCV treated with GS-9256, an HCV NS3 serine protease inhibitor.
24039173 2013 Genetic predictors of risk and resilience in psychiatric disorders: a cross-disorder genome-wide association study of functional impairment in major depressive disorder, bipolar disorder, and schizophrenia.
24002674 2014 Genome-wide association study and meta-analysis of intraocular pressure.
23990450 2014 Golgi fragmentation induced by heat shock or inhibition of heat shock proteins is mediated by non-muscle myosin IIA via its interaction with glycosyltransferases.
23903073 2013 Genome-wide association study of the five-factor model of personality in young Korean women.
23549466 2013 Expression patterns of ?2,3-sialyltransferase I and ?2,6-sialyltransferase I in human cutaneous epithelial lesions.
23275522 2012 Cyclooxygenase-2 enzyme induces the expression of the ?-2,3-sialyltransferase-3 (ST3Gal-I) in breast cancer.
More...