Property Summary

Ligand Count 1
NCBI Gene PubMed Count 34
PubMed Score 61.88
PubTator Score 46.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-02
Amyotrophic lateral sclerosis -1.032 1.2e-07
Breast cancer 1.200 6.7e-06
intraductal papillary-mucinous adenoma (... -1.500 5.4e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
lung carcinoma -1.400 4.2e-18
malignant mesothelioma -1.200 3.6e-06
osteosarcoma 1.191 1.1e-03
ovarian cancer -1.100 8.6e-03
pituitary cancer -1.600 1.6e-02
primary pancreatic ductal adenocarcinoma 1.174 3.2e-03
spina bifida 1.006 3.8e-02
ulcerative colitis 2.800 4.1e-07

Gene RIF (26)

AA Sequence

MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENLKRLIKHRPCTCTHCIGQRKL      1 - 70
SAWFDERFNQTMQPLLTAQNALLEDDTYRWWLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCR     71 - 140
RCAVVGNSGNLRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGDNVSMILVPFK    141 - 210
TIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHGRYPSTGILSVIFSMHV    211 - 280
CDEVDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR              281 - 340
//

Text Mined References (34)

PMID Year Title