Property Summary

Ligand Count 2
NCBI Gene PubMed Count 33
PubMed Score 80.95
PubTator Score 124.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Amyotrophic lateral sclerosis -1.095 2.5e-04
atypical teratoid / rhabdoid tumor -1.100 1.9e-05
glioblastoma -1.100 3.7e-05
juvenile dermatomyositis -1.060 3.8e-08
medulloblastoma, large-cell -1.100 1.4e-03
ovarian cancer -1.200 1.7e-05
psoriasis 1.600 1.9e-32

Gene RIF (17)

AA Sequence

MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQPPELPSDTCTR      1 - 70
YGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWASMESPSHTHGLSHLRGIFNWV     71 - 140
LSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNFQERQLRARLYRQLAPHLRVDVFGRANGRPL    141 - 210
CASCLVPTVAQYRFYLSFENSQHRDYITEKFWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSA    211 - 280
RELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA            281 - 342
//

Text Mined References (34)

PMID Year Title