Property Summary

NCBI Gene PubMed Count 30
Grant Count 49
R01 Count 38
Funding $3,753,179.17
PubMed Score 78.87
PubTator Score 124.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.001
juvenile dermatomyositis -1.060 0.000
Amyotrophic Lateral Sclerosis -1.095 0.000
ovarian cancer -1.200 0.000
psoriasis 1.600 0.000

Gene RIF (15)

PMID Text
24176542 This study presents the first example of a distinct regulatory mechanism involving transcriptional down-regulation of Fut7 by MAPCs that could modulate the trafficking behavior of T cells in vivo.
21197561 After transfection of JAR cells with fucosyltransferase VII, the expression of FUT7 and sLeX synthesis were increased, and the percent adhesion of trophoblast cells to RL95-2 cell monolayer was significantly increased.
20428816 Overexpression of alpha1,3 FucT-VII promoted the expression of CD24 and SLe X and is associated with colorectal carcinoma metastases.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
18452157 This is the first time to report that alpha1,3FucT-VII can regulate the mRNA expression of integrin.
18402946 Overexpression of fucosyltransferase VII (FUT7) promotes embryo adhesion and implantation.
17760744 Observational study of gene-disease association. (HuGE Navigator)
17436081 The up regulation of alpha1,3FucT-VII mRNA and cell surface SLe(x) (alpha1,3FucT-VII product) by UV and down regulation of them by ATRA was speculated to be one of the mechanisms that alpha1,3FucT-VII decreased and increased [susceptibility to] apoptosis.
17229154 Alpha 1,3-fucosyltransferase-VII regulates the signaling molecules of the insulin receptor pathway
More...

AA Sequence

MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQPPELPSDTCTR      1 - 70
YGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWASMESPSHTHGLSHLRGIFNWV     71 - 140
LSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNFQERQLRARLYRQLAPHLRVDVFGRANGRPL    141 - 210
CASCLVPTVAQYRFYLSFENSQHRDYITEKFWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSA    211 - 280
RELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA            281 - 342
//

Publication (31)

PMID Year Title
24176542 2014 Human multipotent adult progenitor cells transcriptionally regulate fucosyltransferase VII.
21197561 2011 sLeX/L-selectin mediates adhesion in vitro implantation model.
20428816 2010 Alpha1,3 fucosyltransferase VII plays a role in colorectal carcinoma metastases by promoting the carbohydration of glycoprotein CD24.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19946888 2010 Defining the membrane proteome of NK cells.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18452157 2008 alpha1,3 fucosyltransferase-VII up-regulates the mRNA of alpha5 integrin and its biological function.
18402946 2009 Overexpression of fucosyltransferase VII (FUT7) promotes embryo adhesion and implantation.
17760744 2007 Evaluation of urinary CA19-9 levels in bladder cancer patients classified according to the combinations of Lewis and Secretor blood group genotypes.
17436081 2007 Alpha1,3 Fucosyltransferase-VII modifies the susceptibility of apoptosis induced by ultraviolet and retinoic acid in human hepatocarcinoma cells.
More...