Property Summary

NCBI Gene PubMed Count 13
PubMed Score 30.86
PubTator Score 34.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683

Synonym

Accession Q11128 A8K4X2
Symbols FUC-TV

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
22619806 FUT5 was expressed on spermatid membranes and in serum, but not in seminal plasma, vaginal fluid and saliva. Expression was localized on head of spermatids.
21978830 down-regulation of FUT3 and FUT5 reduces the expression of sialyl-Lewis antigens and the adhesion capacities of gastric cancer cells and allows to identify the specific alpha1-3,4 fucosyltransferases implicated in the Lewis antigens synthesis
20677162 Observational study of genotype prevalence. (HuGE Navigator)
19349624 results suggested that PKR is the primary target for HSV-1 early RNA during induction of FUT3, FUT5, and FUT6
17148576 FUT5 is a receptor of glycodelin-A and zona pellucida proteins, and glycodelin-A inhibits spermatozoa-zona binding by blocking the binding of sperm FUT5 to the zona pellucida
14601054 Prostatic cancer cell transfected with this enzyme adhered to prostatic stromal cells in vitro with higher affinity than mock-transfected cancer cells.

AA Sequence

MDPLGPAKPQWLWRRCLAGLLFQLLVAVCFFSYLRVSRDDATGSPRPGLMAVEPVTGAPNGSRCQDSMAT      1 - 70
PAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRP     71 - 140
QGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAV    141 - 210
SNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEA    211 - 280
WAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAF    281 - 350
CKACWKLQQESRYQTVRSIAAWFT                                                  351 - 374
//

Publication (16)

PMID Year Title
22619806 2012 [Distribution specificity of human fucosyltransferase 5 and its expression and localization in spermatids].
21978830 2011 Down-regulation of FUT3 and FUT5 by shRNA alters Lewis antigens expression and reduces the adhesion capacities of gastric cancer cells.
20677162 2010 [The genetic diversity in the full coding region of human FUT5 gene in a Chinese Han population].
19349624 2009 Activation of host antiviral RNA-sensing factors necessary for herpes simplex virus type 1-activated transcription of host cell fucosyltransferase genes FUT3, FUT5, and FUT6 and subsequent expression of sLe(x) in virus-infected cells.
17148576 2007 Glycodelin-A interacts with fucosyltransferase on human sperm plasma membrane to inhibit spermatozoa-zona pellucida binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14601054 2003 Gene transfer of alpha1,3-fucosyltransferase increases tumor growth of the PC-3 human prostate cancer cell line through enhanced adhesion to prostatic stromal cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...