Property Summary

NCBI Gene PubMed Count 15
PubMed Score 31.55
PubTator Score 34.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.7e-08

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 1.7e-08

Gene RIF (6)

AA Sequence

MDPLGPAKPQWLWRRCLAGLLFQLLVAVCFFSYLRVSRDDATGSPRPGLMAVEPVTGAPNGSRCQDSMAT      1 - 70
PAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRP     71 - 140
QGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAV    141 - 210
SNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEA    211 - 280
WAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAF    281 - 350
CKACWKLQQESRYQTVRSIAAWFT                                                  351 - 374
//

Text Mined References (18)

PMID Year Title