Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0

Synonym

Accession Q107X0
Symbols KARMA
KRSP1
YKLK1
KLK31P
PsiKLK1

Gene

 GO Component (2)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MSPVHRSRTSQTQEAHKPTSTLSFISPPQPPRQDPKSPHILCSQPNACSRQSHVSYPNPWGLPCSQSKVS      1 - 70
PPGTATNPNPKEWSRISGPPVSLDPQPWSSAPFKPTAQLPLLAQSLGPPAKPALPDPALPLQML           71 - 134
//

Text Mined References (6)

PMID Year Title