Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Prostatic Neoplasms 471

Synonym

Accession Q107X0
Symbols KARMA
KRSP1
YKLK1
KLK31P
PsiKLK1

Gene

 GO Component (2)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
18196551 Transcription from KLKP1 is reduced as cells de-differentiate on the pathway to malignancy in prostate cancer
16541416 KLK31P is a novel androgen regulated and transcribed pseudogene of kallikreins that may play a role in prostate carcinogenesis or maintenance.

AA Sequence

MSPVHRSRTSQTQEAHKPTSTLSFISPPQPPRQDPKSPHILCSQPNACSRQSHVSYPNPWGLPCSQSKVS      1 - 70
PPGTATNPNPKEWSRISGPPVSLDPQPWSSAPFKPTAQLPLLAQSLGPPAKPALPDPALPLQML           71 - 134
//

Text Mined References (6)

PMID Year Title
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23359319 2013 Genome-wide association study identifies loci at ATF7IP and KLK2 associated with percentage of circulating free PSA.
20103546 2010 Kallikreins on steroids: structure, function, and hormonal regulation of prostate-specific antigen and the extended kallikrein locus.
18196551 2008 A novel transcript from the KLKP1 gene is androgen regulated, down-regulated during prostate cancer progression and encodes the first non-serine protease identified from the human kallikrein gene locus.
16541416 2006 KLK31P is a novel androgen regulated and transcribed pseudogene of kallikreins that is expressed at lower levels in prostate cancer cells than in normal prostate cells.
15498522 2004 Cloning of a kallikrein pseudogene.