Property Summary

NCBI Gene PubMed Count 21
PubMed Score 84.04
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 1.2e-03
ovarian cancer 1.800 7.7e-06

Protein-protein Interaction (6)

Gene RIF (4)

AA Sequence

MAAVVLAATRLLRGSGSWGCSRLRFGPPAYRRFSSGGAYPNIPLSSPLPGVPKPVFATVDGQEKFETKVT      1 - 70
TLDNGLRVASQNKFGQFCTVGILINSGSRYEAKYLSGIAHFLEKLAFSSTARFDSKDEILLTLEKHGGIC     71 - 140
DCQTSRDTTMYAVSADSKGLDTVVALLADVVLQPRLTDEEVEMTRMAVQFELEDLNLRPDPEPLLTEMIH    141 - 210
EAAYRENTVGLHRFCPTENVAKINREVLHSYLRNYYTPDRMVLAGVGVEHEHLVDCARKYLLGVQPAWGS    211 - 280
AEAVDIDRSVAQYTGGIAKLERDMSNVSLGPTPIPELTHIMVGLESCSFLEEDFIPFAVLNMMMGGGGSF    281 - 350
SAGGPGKGMFSRLYLNVLNRHHWMYNATSYHHSYEDTGLLCIHASADPRQVREMVEIITKEFILMGGTVD    351 - 420
TVELERAKTQLTSMLMMNLESRPVIFEDVGRQVLATRSRKLPHELCTLIRNVKPEDVKRVASKMLRGKPA    421 - 490
VAALGDLTDLPTYEHIQTALSSKDGRLPRTYRLFR                                       491 - 525
//

Text Mined References (25)

PMID Year Title