Property Summary

NCBI Gene PubMed Count 179
PubMed Score 392.79
PubTator Score 413.18

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 6.2490239074301E-19
juvenile dermatomyositis 1189 1.17173305921746E-16
malignant mesothelioma 3163 2.6465677805739E-9
tuberculosis 1563 5.01935775018998E-6
cutaneous lupus erythematosus 1056 1.76549525659036E-5
lung cancer 4473 1.79917640365306E-5
medulloblastoma, large-cell 6234 3.33718419238147E-5
group 4 medulloblastoma 1875 7.17357071807754E-5
pituitary cancer 1972 2.09101625110971E-4
dermatomyositis 967 3.61744761540615E-4
Multiple myeloma 1328 5.60730288487162E-4
diabetes mellitus 1663 0.00116726961446536
active Crohn's disease 918 0.00143604773365635
pancreatic cancer 2300 0.00150859857585396
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00171661392858031
ovarian cancer 8492 0.00196336702233765
primary pancreatic ductal adenocarcinoma 1271 0.00211147444720017
psoriasis 6685 0.00319822059110695
nasopharyngeal carcinoma 1056 0.00485457521598277
glioblastoma 5572 0.00765047749582731
astrocytoma 1493 0.0109565660839801
cystic fibrosis 1670 0.0117426387119526
non-inflammatory breast cancer 208 0.0134756727725583
subependymal giant cell astrocytoma 2287 0.0181928728003078
active ulcerative colitis 477 0.0186542189023254
Multiple Sclerosis 498 0.020518268151099
esophageal adenocarcinoma 737 0.0212135897576011
acute myeloid leukemia 785 0.0288136787801417


  Differential Expression (28)


Accession Q10589 A8K4Y4 Q53G07 BST-2
Symbols CD317



4P6Z   2LK9   2X7A   2XG7   3MQ7   3MQ9   3MQB   3MQC   3NWH  

  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid

Gene RIF (363)

27396167 BST-2 inhibits the the release of Hepatitis B virus particles. [review]
26789136 Using viral tethering, amino acid level insights into the function of BST-2 were identified.
26742839 studies suggest that Vpu hijacks the FLNa function in the modulation of tetherin to neutralize the antiviral factor tetherin.
26694617 Data suggest that ATP1B3 is binding partner of BST-2 and regulates stability of BST-2; ATP1B3 is co-factor that accelerates BST-2 degradation and reduces BST-2-mediated restriction of HIV-1 replication/tropism and NFkappaB activation.
26675672 Human parainfluenza virus type 2 V protein antagonizes tetherin by binding it and reducing its presence at the cell surface.
26669976 results herein demonstrated that IMB-LA could specifically inhibit the degradation of BST-2 induced by Vpu, and impair HIV-1 replication in a BST-2 dependent manner
26516900 Combining these results suggests an important role for the Ebola virus glycoprotein glycan cap and membrane spanning domain in tetherin antagonism.
26494939 BST2 showed significantly elevated plasma levels and overexpression of BST2 in CRC tissues that correlated with poor survival of colorectal cancer patients.
26439863 HIV-1 Vpus from transmission/founder virus clones downregulates BST2 (Tetherin) but do not efficiently downregulate CD4
26401043 The early evolution of antiviral activity together with the high topology conservation but low sequence homology suggests that restriction of virus release is the primary function of tetherin.

AA Sequence

NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ                                  141 - 180

Text Mined References (195)

PMID Year Title
27396167 2016 [Inhibition of HBV Release by BST-2].
26789136 2016 The Disulfide Bonds within BST-2 Enhance Tensile Strength during Viral Tethering.
26742839 2016 Filamin A Is Involved in HIV-1 Vpu-mediated Evasion of Host Restriction by Modulating Tetherin Expression.
26694617 2016 ATP1B3 Protein Modulates the Restriction of HIV-1 Production and Nuclear Factor ? Light Chain Enhancer of Activated B Cells (NF-?B) Activation by BST-2.
26675672 2016 Human parainfluenza virus type 2 V protein inhibits and antagonizes tetherin.
26669976 2015 A small molecule compound IMB-LA inhibits HIV-1 infection by preventing viral Vpu from antagonizing the host restriction factor BST-2.
26516900 2015 Requirements within the Ebola Viral Glycoprotein for Tetherin Antagonism.
26494939 2015 Bone Marrow Stromal Antigen 2 Is a Novel Plasma Biomarker and Prognosticator for Colorectal Carcinoma: A Secretome-Based Verification Study.
26401043 2015 Early Vertebrate Evolution of the Host Restriction Factor Tetherin.
26248668 2015 Determinants in HIV-2 Env and tetherin required for functional interaction.