Property Summary

NCBI Gene PubMed Count 207
PubMed Score 424.53
PubTator Score 413.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 3.999 1.4e-03
active ulcerative colitis 2.247 1.9e-02
acute myeloid leukemia -1.100 2.9e-02
astrocytoma 1.300 1.1e-02
Breast cancer 1.300 8.3e-03
cutaneous lupus erythematosus 3.300 1.8e-05
cystic fibrosis 1.200 1.2e-02
dermatomyositis 1.700 3.6e-04
diabetes mellitus -1.200 1.2e-03
esophageal adenocarcinoma 2.000 2.1e-02
glioblastoma 1.600 7.7e-03
group 4 medulloblastoma -1.800 7.2e-05
intraductal papillary-mucinous adenoma (... -1.500 1.7e-03
juvenile dermatomyositis 2.208 1.2e-16
lung cancer -1.800 1.8e-05
lung carcinoma -1.800 6.2e-19
malignant mesothelioma 4.700 2.6e-09
medulloblastoma, large-cell -2.100 3.3e-05
Multiple myeloma 1.477 5.6e-04
Multiple Sclerosis 1.400 2.1e-02
nasopharyngeal carcinoma 1.300 4.9e-03
ovarian cancer 2.100 2.0e-03
pancreatic cancer 1.200 1.2e-03
pituitary cancer -1.700 2.1e-04
primary pancreatic ductal adenocarcinoma 1.519 2.1e-03
psoriasis 1.100 3.2e-03
subependymal giant cell astrocytoma 1.274 1.8e-02
tuberculosis 2.000 5.0e-06

Gene RIF (396)

AA Sequence

MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL      1 - 70
QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE     71 - 140
NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ                                  141 - 180
//

Text Mined References (222)

PMID Year Title