Property Summary

NCBI Gene PubMed Count 179
Grant Count 155
R01 Count 68
Funding $33,606,441.49
PubMed Score 392.79
PubTator Score 413.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Synonym

Accession Q10589 A8K4Y4 Q53G07 BST-2
Symbols CD317
TETHERIN

Gene

PDB

4P6Z   2LK9   2X7A   2XG7   3MQ7   3MQ9   3MQB   3MQC   3NWH  

Gene RIF (799)

PMID Text
27396167 BST-2 inhibits the the release of Hepatitis B virus particles. [review]
26789136 Using viral tethering, amino acid level insights into the function of BST-2 were identified.
26742839 studies suggest that Vpu hijacks the FLNa function in the modulation of tetherin to neutralize the antiviral factor tetherin.
26694617 Data suggest that ATP1B3 is binding partner of BST-2 and regulates stability of BST-2; ATP1B3 is co-factor that accelerates BST-2 degradation and reduces BST-2-mediated restriction of HIV-1 replication/tropism and NFkappaB activation.
26675672 Human parainfluenza virus type 2 V protein antagonizes tetherin by binding it and reducing its presence at the cell surface.
26669976 results herein demonstrated that IMB-LA could specifically inhibit the degradation of BST-2 induced by Vpu, and impair HIV-1 replication in a BST-2 dependent manner
26516900 Combining these results suggests an important role for the Ebola virus glycoprotein glycan cap and membrane spanning domain in tetherin antagonism.
26494939 BST2 showed significantly elevated plasma levels and overexpression of BST2 in CRC tissues that correlated with poor survival of colorectal cancer patients.
26439863 HIV-1 Vpus from transmission/founder virus clones downregulates BST2 (Tetherin) but do not efficiently downregulate CD4
26439863 HIV-1 Vpus from transmission/founder virus clones downregulates BST2 (Tetherin) but do not efficiently downregulate CD4
More...

AA Sequence

MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL      1 - 70
QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE     71 - 140
NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ                                  141 - 180
//

Text Mined References (195)

PMID Year Title
27396167 2016 [Inhibition of HBV Release by BST-2].
26789136 2016 The Disulfide Bonds within BST-2 Enhance Tensile Strength during Viral Tethering.
26742839 2016 Filamin A Is Involved in HIV-1 Vpu-mediated Evasion of Host Restriction by Modulating Tetherin Expression.
26694617 2016 ATP1B3 Protein Modulates the Restriction of HIV-1 Production and Nuclear Factor ? Light Chain Enhancer of Activated B Cells (NF-?B) Activation by BST-2.
26675672 2016 Human parainfluenza virus type 2 V protein inhibits and antagonizes tetherin.
26669976 2015 A small molecule compound IMB-LA inhibits HIV-1 infection by preventing viral Vpu from antagonizing the host restriction factor BST-2.
26516900 2015 Requirements within the Ebola Viral Glycoprotein for Tetherin Antagonism.
26494939 2015 Bone Marrow Stromal Antigen 2 Is a Novel Plasma Biomarker and Prognosticator for Colorectal Carcinoma: A Secretome-Based Verification Study.
26401043 2015 Early Vertebrate Evolution of the Host Restriction Factor Tetherin.
26248668 2015 Determinants in HIV-2 Env and tetherin required for functional interaction.
More...