Property Summary

NCBI Gene PubMed Count 49
Grant Count 22
R01 Count 11
Funding $1,438,049.89
PubMed Score 67.74
PubTator Score 72.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -3.100 0.000
psoriasis -1.700 0.000
osteosarcoma -3.455 0.000
cystic fibrosis -1.215 0.000
tuberculosis 3.200 0.000
non-small cell lung cancer -1.107 0.000
fibroadenoma -1.300 0.007
pilocytic astrocytoma 1.300 0.000
lung adenocarcinoma -1.500 0.000
lung carcinoma -1.500 0.000
invasive ductal carcinoma -1.100 0.007
ovarian cancer -1.600 0.000

Gene RIF (30)

PMID Text
25986899 the rs4698412 variant of BST-1 may increase the Parkinson disease susceptibility. [META-ANALYSIS]
25250980 A pre-steady state and steady state kinetic analysis of the N-ribosyl hydrolase activity of hCD157.
24896331 Studies indicate that vertebrate ADP-ribosyl cyclases (ARCs) Bst1 and CD38 with common gene structure of invertebrate ARC, suggesting the origin to the ancestor of bilaterian animals.
24795584 These results demonstrate for the first time that CD157 plays a role as a neuro-regulator and suggest a potential role in pre-motor symptoms in Parkinson's disease.
24753259 These findings indicate a central role of CD157 in cell-extracellular matrix interactions and make CD157 an attractive therapeutic target in inflammation and cancer.
24634087 Autism and with features of regression-previously acquired speech lost in the second year of life. The younger sister, who also had asthma, inherited a maternal deletion of 4p15.32 that results in a BST1-CD38 fusion transcript.
24413464 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
24413464 A ligand-receptor complex SCRG1/BST1 axis facilitate mesenchymal stem cells migration, preserve OCT4 and CD271 expression, self-renewal and osteogenic differentiation.
24342025 BST1 rs11724635 polymorphism can interact with well water drinking to increase the risk of Parkinson's disease in a Taiwanese population.
23853107 The results of this study indicated that the SNCA and BST1 SNPs generally increase the risk of developing PD and that SNCA rs11931074 in particular is associated with a higher risk of parkinson disease with family history.
More...

AA Sequence

MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI      1 - 70
WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF     71 - 140
LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE    141 - 210
IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC    211 - 280
ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL                                    281 - 318
//

Text Mined References (52)

PMID Year Title
25986899 2015 Association between bone marrow stromal cell antigen 1 gene polymorphisms and the susceptibility to Parkinson's disease: a meta-analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25250980 2014 A pre-steady state and steady state kinetic analysis of the N-ribosyl hydrolase activity of hCD157.
25064009 2014 Large-scale meta-analysis of genome-wide association data identifies six new risk loci for Parkinson's disease.
24896331 2014 The ADP-ribosyl cyclases--the current evolutionary state of the ARCs.
24795584 2014 Anxiety- and depression-like behavior in mice lacking the CD157/BST1 gene, a risk factor for Parkinson's disease.
24753259 2014 Binding of CD157 protein to fibronectin regulates cell adhesion and spreading.
24634087 2014 A deletion involving CD38 and BST1 results in a fusion transcript in a patient with autism and asthma.
24413464 2014 Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.
24342025 2014 BST1 rs11724635 interacts with environmental factors to increase the risk of Parkinson's disease in a Taiwanese population.
More...