Property Summary

NCBI Gene PubMed Count 49
PubMed Score 73.33
PubTator Score 72.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 2.9e-06
cystic fibrosis -1.215 1.8e-04
fibroadenoma -1.300 7.3e-03
invasive ductal carcinoma -1.100 6.7e-03
lung adenocarcinoma -1.500 3.6e-11
lung carcinoma -1.500 4.7e-19
malignant mesothelioma -3.100 6.6e-09
non-small cell lung cancer -1.107 1.5e-14
osteosarcoma -3.455 5.5e-06
ovarian cancer -1.600 2.7e-07
psoriasis -1.700 9.6e-05
tuberculosis 3.200 6.8e-08

Gene RIF (30)

AA Sequence

MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAI      1 - 70
WEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADF     71 - 140
LSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYE    141 - 210
IPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDC    211 - 280
ALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL                                    281 - 318
//

Text Mined References (52)

PMID Year Title