Property Summary

NCBI Gene PubMed Count 21
PubMed Score 1071.79
PubTator Score 319.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.400 1.1e-07
astrocytic glioma -1.400 2.4e-02
Astrocytoma, Pilocytic -1.400 2.1e-07
atypical teratoid / rhabdoid tumor -3.400 1.7e-11
ductal carcinoma in situ -1.600 9.2e-05
ependymoma -1.800 4.0e-02
glioblastoma -2.400 3.5e-12
group 3 medulloblastoma -2.200 1.1e-05
head and neck cancer -1.200 2.1e-03
invasive ductal carcinoma -2.700 1.6e-04
medulloblastoma, large-cell -2.700 1.3e-05
non primary Sjogren syndrome sicca 1.100 2.5e-02
ovarian cancer -2.200 1.6e-13
primitive neuroectodermal tumor -2.700 1.0e-06
subependymal giant cell astrocytoma -1.946 1.1e-02
ulcerative colitis -1.200 2.2e-07

Gene RIF (7)

AA Sequence

MSDAGGGKKPPVDPQAGPGPGPGRAAGERGLSGSFPLVLKKLMENPPREARLDKEKGKEKLEEDEAAAAS      1 - 70
TMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAELEGKESASSSTAS     71 - 140
PPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAE    141 - 210
EDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVA    211 - 280
ELRKEVGKCKTIVSKYETKYGPL                                                   281 - 303
//

Text Mined References (23)

PMID Year Title