Property Summary

NCBI Gene PubMed Count 20
Grant Count 97
R01 Count 77
Funding $13,431,966.71
PubMed Score 1014.68
PubTator Score 319.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Gene

TEF

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
24581835 findings show the polymorphisms of Cry1 rs2287161 and Tef rs738499 are associated to major depressive disorder in the Chinese population
23138696 The polymorphism of Tef rs738499 is associated with depression symptoms in parkinson disease.
22257907 the TT genotype in Tef rs738499 is associated with sleep disturbances in Parkinson disease.
21347262 evidence of TEF regulation through a miR-125b-mediated pathway
20396431 Observational study of gene-disease association. (HuGE Navigator)
15665112 TEF-expressing cells accumulated in G(0)/G(1) phase without undergoing apoptosis.

AA Sequence

MSDAGGGKKPPVDPQAGPGPGPGRAAGERGLSGSFPLVLKKLMENPPREARLDKEKGKEKLEEDEAAAAS      1 - 70
TMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAELEGKESASSSTAS     71 - 140
PPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAE    141 - 210
EDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVA    211 - 280
ELRKEVGKCKTIVSKYETKYGPL                                                   281 - 303
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24581835 2014 Cry1 and Tef gene polymorphisms are associated with major depressive disorder in the Chinese population.
23138696 2012 Association of Tef polymorphism with depression in Parkinson disease.
22257907 2012 Tef polymorphism is associated with sleep disturbances in patients with Parkinson's disease.
21347262 2011 A novel pathway of TEF regulation mediated by microRNA-125b contributes to the control of actin distribution and cell shape in fibroblasts.
20396431 2010 Genotyping sleep disorders patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15665112 2005 TEF, an antiapoptotic bZIP transcription factor related to the oncogenic E2A-HLF chimera, inhibits cell growth by down-regulating expression of the common beta chain of cytokine receptors.
More...