Property Summary

NCBI Gene PubMed Count 222
Grant Count 72
R01 Count 41
Funding $6,959,107.54
PubMed Score 1072.92
PubTator Score 666.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P02774 B4DPP2 D6RAK8 Q16309 Q16310 Q53F31 Q6GTG1 DBP
Symbols DBP
GRD3
VDBG
VDBP
GcMAF
DBP/GC
Gc-MAF
HEL-S-51

Gene

GC

PDB

1J78   1J7E   1KW2   1KXP   1LOT   1MA9  

Gene RIF (186)

PMID Text
26924582 Association between common DBP variants and serum protein levels.
26751954 Urinary VDBP and KIM-1 are potent new biomarkers of major adverse renal events in patients undergoing coronary angiography.
26733479 Direct measurements of free 25(OH)D reduce the differences seen in total 25(OH)D between DBP phenotype groups and sexes, probably caused by differences in DBP concentrations.
26575331 Genetic variants in the vitamin D pathway genes VDBP and RXRA modulate cutaneous melanoma disease-specific survival.
26404398 presence of a particular GC gene allelic version, GC*3, observed for the first time in the Lebanese population, and found to be associated with both normal vitamin D and high DBP levels
26400306 The VDBP genotype GC*1F-1F or allele GC*1F was associated with increased susceptibility to chronic obstructive pulmonary disease in Asians. (Meta-analysis)
26260969 Polymorphisms associated with lower DBP level attenuated the association between low serum 25(OH)D3 level and food allergy, consistent with greater vitamin D bioavailability in those with a lower DBP level.
26067474 The Gc2 variant was associated with a decrease in the frequency of Bronchopulmonary dysplasia .
26064917 Despite urinary losses of VDBP, CKD patients had higher serum VDBP concentrations, indicating compensatory enhanced production. Vitamin D binding protein is not involved in vitamin D deficiency.
26046356 indicate apolipoprotein E (ApoE) and two isoforms of vitamin D binding protein (DBP) as biomarkers to subdivide the multiple sclerosis (MS) patients into subgroups correlated with clinical classification.
More...

AA Sequence

MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSL      1 - 70
TEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPT     71 - 140
NDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLS    141 - 210
LLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPE    211 - 280
HTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFEL    281 - 350
SRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKK    351 - 420
KLAERLKAKLPDATPKELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL                    421 - 474
//

Text Mined References (230)

PMID Year Title
26924582 2016 Characterization of additional vitamin D binding protein variants.
26751954 2016 Urinary Vitamin D Binding Protein and KIM-1 Are Potent New Biomarkers of Major Adverse Renal Events in Patients Undergoing Coronary Angiography.
26733479 2016 Effects of vitamin D binding protein phenotypes and vitamin D supplementation on serum total 25(OH)D and directly measured free 25(OH)D.
26575331 2016 Genetic variants in the vitamin D pathway genes VDBP and RXRA modulate cutaneous melanoma disease-specific survival.
26404398 2015 Hypovitaminosis D in a Young Lebanese Population: Effect of GC Gene Polymorphisms on Vitamin D and Vitamin D Binding Protein Levels.
26400306 2015 Association of vitamin D-binding protein variants with chronic obstructive pulmonary disease: a meta-analysis.
26260969 2016 Polymorphisms affecting vitamin D-binding protein modify the relationship between serum vitamin D (25[OH]D3) and food allergy.
26067474 2015 Association of vitamin D binding protein polymorphisms with bronchopulmonary dysplasia: a case-control study of gc globulin and bronchopulmonary dysplasia.
26064917 2015 Vitamin D Binding Protein Is Not Involved in Vitamin D Deficiency in Patients with Chronic Kidney Disease.
26046356 2015 Vitamin D Binding Protein Isoforms and Apolipoprotein E in Cerebrospinal Fluid as Prognostic Biomarkers of Multiple Sclerosis.
More...