Property Summary

NCBI Gene PubMed Count 52
Grant Count 3
Funding $348,216.5
PubMed Score 28.92
PubTator Score 2069.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (30)

PMID Text
25890042 The interaction between vitamin D status, as measured by circulating 25(OH)D and DBP rs2282679 genotypes, modified the association between 25(OH)D and BMD and bone markers.
25590278 Increased circulating levels of vitamin D binding protein in multiple sclerosis patients.
25503293 the expression of DBP and MAPK in epilepsy patients was upregulated, suggesting a possible pathogenetic role in IE.
25428203 Results show that APOE, DBP and AGT identified were associated with survival outcomes in metastatic colorectal cancer patients treated with chemotherapy and bevacizumab.
25230725 DBP strictly inhibited the production of 1alpha,25-dihydroxyvitamin D3 and 25-hydroxyvitamin D3-induced T cell responses.
24885631 25(OH)D2 half-life was shorter than 25(OH)D3 half-life, and half-lives were affected by DBP concentration and genotype.
21411511 Lean individuals exhibited significant (P < 0.05) temporal changes of core clock (PER1, PER2, PER3, CRY2, BMAL1, and DBP) and metabolic (REVERBalpha, RIP140, and PGC1alpha) genes.
20174623 Observational study of gene-disease association. (HuGE Navigator)
20072116 Observational study of gene-disease association. (HuGE Navigator)
20007432 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPAATTPGPGLET      1 - 70
AGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGPSP     71 - 140
EPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPA    141 - 210
DLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKE    211 - 280
NQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL                             281 - 325
//

Text Mined References (54)

PMID Year Title
25890042 2015 Relationship of vitamin D status and bone mass according to vitamin D-binding protein genotypes.
25590278 2015 Increased circulating levels of vitamin D binding protein in MS patients.
25503293 2015 Upregulation of D site of albumin promoter binding protein in the brain of patients with intractable epilepsy.
25428203 2014 Predicting response to vascular endothelial growth factor inhibitor and chemotherapy in metastatic colorectal cancer.
25230725 2014 Vitamin D-binding protein controls T cell responses to vitamin D.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24885631 2014 25(OH)D2 half-life is shorter than 25(OH)D3 half-life and is influenced by DBP concentration and genotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
More...