Property Summary

NCBI Gene PubMed Count 53
PubMed Score 28.56
PubTator Score 2069.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma 1.176 1.1e-03
adult high grade glioma -1.800 5.2e-06
Astrocytoma, Pilocytic -1.100 2.0e-05
ductal carcinoma in situ -1.200 6.1e-03
ependymoma -1.200 1.4e-07
glioblastoma -1.500 1.4e-09
malignant mesothelioma 1.300 3.9e-06
osteosarcoma -1.078 1.8e-02
pituitary cancer 1.400 5.8e-05
primitive neuroectodermal tumor -1.500 1.8e-05
sonic hedgehog group medulloblastoma -1.100 5.7e-04
subependymal giant cell astrocytoma -1.152 1.0e-02

Gene RIF (31)

AA Sequence

MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPAATTPGPGLET      1 - 70
AGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGPSP     71 - 140
EPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPA    141 - 210
DLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKE    211 - 280
NQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQAQHGAL                             281 - 325
//

Text Mined References (55)

PMID Year Title