Property Summary

NCBI Gene PubMed Count 37
Grant Count 39
R01 Count 30
Funding $4,830,971.66
PubMed Score 579.26
PubTator Score 123.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.000
malignant mesothelioma -1.100 0.000
oligodendroglioma 1.300 0.013
glioblastoma -1.300 0.009
group 4 medulloblastoma -2.500 0.000
cystic fibrosis -1.755 0.000
medulloblastoma, large-cell -2.700 0.000
Duchenne muscular dystrophy -1.568 0.000
autosomal dominant Emery-Dreifuss muscul... -1.085 0.001
juvenile dermatomyositis -1.184 0.000
limb girdle muscular dystrophy 2B -1.301 0.000
acute quadriplegic myopathy -1.979 0.000
tuberculosis -3.900 0.000
non-small cell lung cancer 1.094 0.000
Hydrolethalus syndrome -1.222 0.006
lung cancer -1.300 0.004
adult high grade glioma -2.000 0.000
ovarian cancer -1.900 0.000
pituitary cancer -1.200 0.029
head and neck cancer -1.500 0.017

Gene RIF (27)

PMID Text
26927674 MLL1 and DOT1L cooperate with meningioma-1 to induce acute myeloid leukemia.
26545049 MN1 deletion is associated with Craniofacial Abnormalities.
26111797 these results suggest that deregulated MN1 expression contributes to the pathogenesis of pediatric B-ALL.
25944382 Chromosome 22q12.1 microdeletions involving the MN1 gene confirm it as a candidate gene for cleft palate.
25810350 genotype-phenotype correlation among our patients and those previously reported with overlapping 22q12 deletions, we identified a 560 kb critical region containing the MN1 gene that is implicated in human cleft palate formation
25549701 identified potential driver mutations in NF2 (neurofibromatosis type 2) and MN1 (meningioma 1).
25339361 cotransduction of an activated HOX gene (NUP98HOXD13) with MN1 induces a serially transplantable acute myeloid leukemia (AML).
23515710 High MN1 expression confers worse prognosis in Chinese adult patients with de novo acute myeloid leukemia.
23394438 MN1 overexpression independently predicts bad clinical outcome in CN-AML patients
22905229 Overexpression of MN1 confers resistance to chemotherapy, accelerates leukemia onset, and suppresses p53 and Bim induction
More...

AA Sequence

MFGLDQFEPQVNSRNAGQGERNFNETGLSMNTHFKAPAFHTGGPPGPVDPAMSALGEPPILGMNMEPYGF      1 - 70
HARGHSELHAGGLQAQPVHGFFGGQQPHHGHPGSHHPHQHHPHFGGNFGGPDPGASCLHGGRLLGYGGAA     71 - 140
GGLGSQPPFAEGYEHMAESQGPESFGPQRPGNLPDFHSSGASSHAVPAPCLPLDQSPNRAASFHGLPSSS    141 - 210
GSDSHSLEPRRVTNQGAVDSLEYNYPGEAPSGHFDMFSPSDSEGQLPHYAAGRQVPGGAFPGASAMPRAA    211 - 280
GMVGLSKMHAQPPQQQPQQQQQPQQQQQQHGVFFERFSGARKMPVGLEPSVGSRHPLMQPPQQAPPPPQQ    281 - 350
QPPQQPPQQQPPPPPGLLVRQNSCPPALPRPQQGEAGTPSGGLQDGGPMLPSQHAQFEYPIHRLENRSMH    351 - 420
PYSEPVFSMQHPPPQQAPNQRLQHFDAPPYMNVAKRPRFDFPGSAGVDRCASWNGSMHNGALDNHLSPSA    421 - 490
YPGLPGEFTPPVPDSFPSGPPLQHPAPDHQSLQQQQQQQQQQQQQQQQQQQQQQQQQQQQRQNAALMIKQ    491 - 560
MASRNQQQRLRQPNLAQLGHPGDVGQGGLVHGGPVGGLAQPNFEREGGSTGAGRLGTFEQQAPHLAQESA    561 - 630
WFSGPHPPPGDLLPRRMGGSGLPADCGPHDPSLAPPPPPGGSGVLFRGPLQEPMRMPGEGHVPALPSPGL    631 - 700
QFGGSLGGLGQLQSPGAGVGLPSAASERRPPPPDFATSALGGQPGFPFGAAGRQSTPHSGPGVNSPPSAG    701 - 770
GGGGSSGGGGGGGAYPPQPDFQPSQRTSASKLGALSLGSFNKPSSKDNLFGQSCLAALSTACQNMIASLG    771 - 840
APNLNVTFNKKNPPEGKRKLSQNETDGAAVAGNPGSDYFPGGTAPGAPGPGGPSGTSSSGSKASGPPNPP    841 - 910
AQGDGTSLSPNYTLESTSGNDGKPVSGGGGRGRGRRKRDSGHVSPGTFFDKYSAAPDSGGAPGVSPGQQQ    911 - 980
ASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGDQPDLIGSLDGGAKSDSSSPNVGEFASDEVS    981 - 1050
TSYANEDEVSSSSDNPQALVKASRSPLVTGSPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGG   1051 - 1120
GGGPGHPGTPGLEQVRTPTSSSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGAS   1121 - 1190
GAQNGDSELGSCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKE   1191 - 1260
AHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT             1261 - 1320
//

Text Mined References (41)

PMID Year Title
26927674 2016 MLL1 and DOT1L cooperate with meningioma-1 to induce acute myeloid leukemia.
26545049 2016 Microdeletion del(22)(q12.1) excluding the MN1 gene in a patient with craniofacial anomalies.
26111797 2015 High MN1 expression increases the in vitro clonogenic activity of primary mouse B-cells.
25944382 2016 Chromosome 22q12.1 microdeletions: confirmation of the MN1 gene as a candidate gene for cleft palate.
25810350 2015 Craniofacial abnormalities and developmental delay in two families with overlapping 22q12.1 microdeletions involving the MN1 gene.
25549701 2014 Exome sequencing on malignant meningiomas identified mutations in neurofibromatosis type 2 (NF2) and meningioma 1 (MN1) genes.
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
25339361 2014 Modeling de novo leukemogenesis from human cord blood with MN1 and NUP98HOXD13.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
23515710 2013 The clinical characteristics and prognostic significance of MN1 gene and MN1-associated microRNA expression in adult patients with de novo acute myeloid leukemia.
More...