Property Summary

NCBI Gene PubMed Count 38
PubMed Score 614.49
PubTator Score 123.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy -1.979 4.1e-06
adult high grade glioma -2.000 2.2e-04
autosomal dominant Emery-Dreifuss muscul... -1.085 1.3e-03
cystic fibrosis -1.755 9.5e-05
Duchenne muscular dystrophy -1.568 1.9e-09
glioblastoma -1.300 9.1e-03
group 3 medulloblastoma -1.700 1.3e-02
head and neck cancer -1.500 1.7e-02
hepatocellular carcinoma -1.100 8.5e-05
Hydrolethalus syndrome -1.222 6.2e-03
juvenile dermatomyositis -1.184 3.8e-07
limb girdle muscular dystrophy 2A -1.122 6.7e-05
lung cancer -1.300 3.8e-03
malignant mesothelioma -1.100 1.2e-05
medulloblastoma, large-cell -2.700 2.7e-04
non-small cell lung cancer 1.094 5.6e-06
oligodendroglioma 1.300 1.3e-02
ovarian cancer -1.900 1.1e-09
pituitary cancer -1.200 2.9e-02
tuberculosis -3.900 3.5e-06

Gene RIF (28)

AA Sequence

MFGLDQFEPQVNSRNAGQGERNFNETGLSMNTHFKAPAFHTGGPPGPVDPAMSALGEPPILGMNMEPYGF      1 - 70
HARGHSELHAGGLQAQPVHGFFGGQQPHHGHPGSHHPHQHHPHFGGNFGGPDPGASCLHGGRLLGYGGAA     71 - 140
GGLGSQPPFAEGYEHMAESQGPESFGPQRPGNLPDFHSSGASSHAVPAPCLPLDQSPNRAASFHGLPSSS    141 - 210
GSDSHSLEPRRVTNQGAVDSLEYNYPGEAPSGHFDMFSPSDSEGQLPHYAAGRQVPGGAFPGASAMPRAA    211 - 280
GMVGLSKMHAQPPQQQPQQQQQPQQQQQQHGVFFERFSGARKMPVGLEPSVGSRHPLMQPPQQAPPPPQQ    281 - 350
QPPQQPPQQQPPPPPGLLVRQNSCPPALPRPQQGEAGTPSGGLQDGGPMLPSQHAQFEYPIHRLENRSMH    351 - 420
PYSEPVFSMQHPPPQQAPNQRLQHFDAPPYMNVAKRPRFDFPGSAGVDRCASWNGSMHNGALDNHLSPSA    421 - 490
YPGLPGEFTPPVPDSFPSGPPLQHPAPDHQSLQQQQQQQQQQQQQQQQQQQQQQQQQQQQRQNAALMIKQ    491 - 560
MASRNQQQRLRQPNLAQLGHPGDVGQGGLVHGGPVGGLAQPNFEREGGSTGAGRLGTFEQQAPHLAQESA    561 - 630
WFSGPHPPPGDLLPRRMGGSGLPADCGPHDPSLAPPPPPGGSGVLFRGPLQEPMRMPGEGHVPALPSPGL    631 - 700
QFGGSLGGLGQLQSPGAGVGLPSAASERRPPPPDFATSALGGQPGFPFGAAGRQSTPHSGPGVNSPPSAG    701 - 770
GGGGSSGGGGGGGAYPPQPDFQPSQRTSASKLGALSLGSFNKPSSKDNLFGQSCLAALSTACQNMIASLG    771 - 840
APNLNVTFNKKNPPEGKRKLSQNETDGAAVAGNPGSDYFPGGTAPGAPGPGGPSGTSSSGSKASGPPNPP    841 - 910
AQGDGTSLSPNYTLESTSGNDGKPVSGGGGRGRGRRKRDSGHVSPGTFFDKYSAAPDSGGAPGVSPGQQQ    911 - 980
ASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGDQPDLIGSLDGGAKSDSSSPNVGEFASDEVS    981 - 1050
TSYANEDEVSSSSDNPQALVKASRSPLVTGSPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGG   1051 - 1120
GGGPGHPGTPGLEQVRTPTSSSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGAS   1121 - 1190
GAQNGDSELGSCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKE   1191 - 1260
AHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT             1261 - 1320
//

Text Mined References (42)

PMID Year Title