Property Summary

NCBI Gene PubMed Count 31
PubMed Score 33.46
PubTator Score 8.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 1.4e-03
astrocytoma 1146 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Globe disease 67 0.0 1.2
Disease Target Count Z-score Confidence
Meningioma 41 4.112 2.1
Pain agnosia 104 3.571 1.8
Neurofibromatosis 40 3.0 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytoma 1.300 3.5e-03
osteosarcoma -1.037 1.4e-03

Protein-protein Interaction (1)

Gene RIF (24)

AA Sequence

MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVY      1 - 70
LYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKT     71 - 140
AAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTA    141 - 210
LNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTL    211 - 280
LKKLAPPLVTLLSAEPELQYVALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQAN    281 - 350
IAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRK    351 - 420
YPNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQVQLQLLTAIVK    421 - 490
LFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVVLAEKPLISEETDLIEPTLL    491 - 560
DELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSESAESPETAPTGAPPGEQPDVIPAQGDLLG    561 - 630
DLLNLDLGPPVSGPPLATSSVQMGAVDLLGGGLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAPIGSGLS    631 - 700
DLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNS    701 - 770
FGLAPATPLQVHAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGK    771 - 840
MDRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLKLTNGIWVLA    841 - 910
ELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAYETILKN                                   911 - 949
//

Text Mined References (37)

PMID Year Title