Property Summary

NCBI Gene PubMed Count 42
PubMed Score 16.71
PubTator Score 29.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma 1.100 5.6e-10
Atopic dermatitis -1.100 3.1e-03
atypical teratoid / rhabdoid tumor 1.100 7.9e-04
diabetes mellitus -1.100 1.0e-02
glioblastoma 1.400 4.8e-04
intraductal papillary-mucinous adenoma (... 1.500 1.9e-03
intraductal papillary-mucinous carcinoma... 1.800 3.0e-03
invasive ductal carcinoma 1.011 1.1e-02
juvenile dermatomyositis 1.013 2.4e-09
lung cancer 1.200 6.7e-04
Multiple myeloma 1.868 1.5e-03
osteosarcoma 1.639 2.7e-03
ovarian cancer -2.400 5.2e-07
pituitary cancer -1.100 1.8e-03
psoriasis -1.500 2.2e-04
subependymal giant cell astrocytoma 1.521 4.6e-02
Waldenstrons macroglobulinemia 1.666 1.1e-02
X-linked cerebral adrenoleukodystrophy 1.300 4.0e-02

 CSPA Cell Line (1)

Gene RIF (17)

AA Sequence

MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKE      1 - 70
DQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVI     71 - 140
NRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDA    141 - 210
HCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKG    211 - 280
DRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKAT    281 - 350
PYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYP    351 - 420
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNG    421 - 490
PVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF     491 - 559
//

Text Mined References (43)

PMID Year Title