Property Summary

NCBI Gene PubMed Count 40
Grant Count 11
Funding $2,976,865.43
PubMed Score 15.08
PubTator Score 29.75

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (16)

PMID Text
26714046 Expression of GALNT3 was reduced in CAD patients, and down regulation of GALNT3 contributed to endothelial injury by promoting apoptosis and up-regulating the expression of MMP-2 and MMP-14 genes via p38 MAPK activation.
26676748 appears to be responsive to the inhibition of GALNT1 and SHH signaling
25730904 Study demonstrates that down-regulation of GALNT1 is sufficient to suppress malignant phenotype of HCC cells by decreasing EGFR signaling.
23317233 High ppGalNAc T1 expresdsion is associated with bladder cancer.
22183981 The GALNT1 is the glycosyltransferase enzyme family covering a single known glycosidic linkage.
22042768 Utilizing unnatural glycopeptide substrates for GalNAc-T3 we demonstrated that the GalNAc-specific sugar recognition of the lectin domain regulates further glycosylation.
21349845 each ppGalNAc T isoform may be uniquely sensitive to peptide sequence and overall charge, which together dictates the substrate sites that will be glycosylated
20498016 Growth factor stimulation regulates O-glycosylation initiation in a Src-dependent fashion by GalNac-T redistribution from golgi to the endoplasmic reticulum.
20142253 the present analysis fails to replicate an earlier reported association of a GALNT1 variant with risk of ovarian cancer
19524017 Data show that the sequences and O-glycosylation patterns direct the addition of the first and second sugar residues by ppGalNAc-T and C1GalT which act in a site directed fashion.
More...

AA Sequence

MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKE      1 - 70
DQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVI     71 - 140
NRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDA    141 - 210
HCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKG    211 - 280
DRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKAT    281 - 350
PYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYP    351 - 420
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNG    421 - 490
PVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF     491 - 559
//

Text Mined References (41)

PMID Year Title
26714046 2016 Down regulation of GALNT3 contributes to endothelial cell injury via activation of p38 MAPK signaling pathway.
26676748 2016 GALNT1-Mediated Glycosylation and Activation of Sonic Hedgehog Signaling Maintains the Self-Renewal and Tumor-Initiating Capacity of Bladder Cancer Stem Cells.
25730904 2015 Knockdown of GALNT1 suppresses malignant phenotype of hepatocellular carcinoma by suppressing EGFR signaling.
24223155 2013 Genome wide analysis of drug-induced torsades de pointes: lack of common variants with large effect sizes.
23317233 2012 ppGalNAc T1 as a potential novel marker for human bladder cancer.
22183981 2012 Control of mucin-type O-glycosylation: a classification of the polypeptide GalNAc-transferase gene family.
22042768 2012 Elucidation of the sugar recognition ability of the lectin domain of UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3 by using unnatural glycopeptide substrates.
21349845 2011 Emerging paradigms for the initiation of mucin-type protein O-glycosylation by the polypeptide GalNAc transferase family of glycosyltransferases.
21269460 2011 Initial characterization of the human central proteome.
20498016 2010 Regulation of O-glycosylation through Golgi-to-ER relocation of initiation enzymes.
More...