Property Summary

NCBI Gene PubMed Count 68
PubMed Score 28.20
PubTator Score 44.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 4.95949245863595E-19
non-small cell lung cancer 2798 2.72168607562012E-16
posterior fossa group A ependymoma 1511 7.52651542410819E-9
Breast cancer 3099 1.95065863300102E-7
ulcerative colitis 2087 2.03039111628675E-7
malignant mesothelioma 3163 4.52018916167758E-7
ovarian cancer 8492 3.77332625728726E-6
glioblastoma 5572 1.65798625856906E-5
pediatric high grade glioma 2712 7.97199032425024E-5
lung cancer 4473 1.3997989571234E-4
pilocytic astrocytoma 3086 1.52368917348817E-4
Multiple myeloma 1328 2.90774600108692E-4
lung adenocarcinoma 2714 4.05271125987005E-4
astrocytoma 1493 5.4262559499689E-4
atypical teratoid / rhabdoid tumor 4369 6.60224541133071E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.001663346458883
osteosarcoma 7933 0.00440786792218655
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00564546018201396
oligodendroglioma 2849 0.0110490255397846
gastric carcinoma 832 0.0117899282129237
Waldenstrons macroglobulinemia 765 0.0145270720888828
diabetes mellitus 1663 0.0158299668180378
active Crohn's disease 918 0.0218375962833488
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0268527752215068

Expression

Synonym

Accession Q10471 A8K1Y3 B7Z8V8 C5HU00 Q9NPY4
Symbols GalNAc-T2

Gene

PANTHER Protein Class (2)

PDB

5AJN   5AJO   5AJP   2FFU   2FFV   4D0T   4D0Z   4D11   5FV9  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA EggNOG Inparanoid

Gene RIF (38)

PMID Text
26817450 The results suggest that rs4846913 and rs2144300 drive the association to HDL-C plasma levels through an inhibitory regulation of GALNT2.
26637976 Multiple hepatic regulatory variants at the GALNT2 GWAS locus have been found associated with high-density lipoprotein cholesterol.
26405973 The present work indicates that SNP rs4846914 in GALNT2 gene is related to an increased risk of hypertension in China Han population, but the APOE gene is not.
25744272 Downregulation of GALNT2 is associated with IgA nephropathy.
25362349 Our findings suggest that GALNT2 regulates malignant phenotypes of neuroblastoma cells
25084356 promoter DNA hypermethylation of the ABCG1 and GALNT2 genes, but not the HMGCR gene, is associated with an increased risk of CHD.
24740207 genome-wide association study in population in Finland: Data suggest that one SNP in GALNT2 (rs6684432) and two SNPs in VDBP (vitamin D binding protein; rs7041, rs705117) are associated with serum levels of VDBP in the male population studied.
24582885 findings suggest that GALNT2 plays an important role in the invasive behavior of OSCC and that targeting GALNT2 could be a promising approach for OSCC therapy
23912186 Endoplasmic reticulum localization of GalNAc-T2 Is Sufficient to Drive High Tn Expression.
23894607 GALNT2 is down-regulated in patients with type 2 diabetes
More...

AA Sequence

MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQSMET      1 - 70
LPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSV     71 - 140
VITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVR    141 - 210
GADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVF    211 - 280
KWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLE    281 - 350
IIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKK    351 - 420
LSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSV    421 - 490
KHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALS    491 - 560
QQWKFTLNLQQ                                                               561 - 571
//

Text Mined References (72)

PMID Year Title
26817450 2016 Looking beyond GWAS: allele-specific transcription factor binding drives the association of GALNT2 to HDL-C plasma levels.
26637976 2015 Multiple Hepatic Regulatory Variants at the GALNT2 GWAS Locus Associated with High-Density Lipoprotein Cholesterol.
26405973 2015 Gene environment interaction of GALNT2 and APOE gene with hypertension in the Chinese Han Population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25744272 2015 Role of let-7b in the regulation of N-acetylgalactosaminyltransferase 2 in IgA nephropathy.
25416956 2014 A proteome-scale map of the human interactome network.
25362349 2014 GALNT2 suppresses malignant phenotypes through IGF-1 receptor and predicts favorable prognosis in neuroblastoma.
25084356 2014 A preliminary study of the relationship between promoter methylation of the ABCG1, GALNT2 and HMGCR genes and coronary heart disease.
24740207 2014 Genome-wide association study of circulating vitamin D-binding protein.
24582885 2014 GALNT2 enhances migration and invasion of oral squamous cell carcinoma by regulating EGFR glycosylation and activity.
More...