Property Summary

NCBI Gene PubMed Count 68
Grant Count 4
Funding $565,494.5
PubMed Score 28.20
PubTator Score 44.97

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q10471 A8K1Y3 B7Z8V8 C5HU00 Q9NPY4
Symbols GalNAc-T2

Gene

PANTHER Protein Class (2)

PDB

5AJN   5AJO   5AJP   2FFU   2FFV   4D0T   4D0Z   4D11   5FV9  

Gene RIF (38)

PMID Text
26817450 The results suggest that rs4846913 and rs2144300 drive the association to HDL-C plasma levels through an inhibitory regulation of GALNT2.
26637976 Multiple hepatic regulatory variants at the GALNT2 GWAS locus have been found associated with high-density lipoprotein cholesterol.
26405973 The present work indicates that SNP rs4846914 in GALNT2 gene is related to an increased risk of hypertension in China Han population, but the APOE gene is not.
25744272 Downregulation of GALNT2 is associated with IgA nephropathy.
25362349 Our findings suggest that GALNT2 regulates malignant phenotypes of neuroblastoma cells
25084356 promoter DNA hypermethylation of the ABCG1 and GALNT2 genes, but not the HMGCR gene, is associated with an increased risk of CHD.
24740207 genome-wide association study in population in Finland: Data suggest that one SNP in GALNT2 (rs6684432) and two SNPs in VDBP (vitamin D binding protein; rs7041, rs705117) are associated with serum levels of VDBP in the male population studied.
24582885 findings suggest that GALNT2 plays an important role in the invasive behavior of OSCC and that targeting GALNT2 could be a promising approach for OSCC therapy
23912186 Endoplasmic reticulum localization of GalNAc-T2 Is Sufficient to Drive High Tn Expression.
23894607 GALNT2 is down-regulated in patients with type 2 diabetes
More...

AA Sequence

MRRRSRMLLCFAFLWVLGIAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQSMET      1 - 70
LPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSV     71 - 140
VITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVR    141 - 210
GADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVF    211 - 280
KWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLE    281 - 350
IIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKK    351 - 420
LSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSV    421 - 490
KHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALS    491 - 560
QQWKFTLNLQQ                                                               561 - 571
//

Text Mined References (72)

PMID Year Title
26817450 2016 Looking beyond GWAS: allele-specific transcription factor binding drives the association of GALNT2 to HDL-C plasma levels.
26637976 2015 Multiple Hepatic Regulatory Variants at the GALNT2 GWAS Locus Associated with High-Density Lipoprotein Cholesterol.
26405973 2015 Gene environment interaction of GALNT2 and APOE gene with hypertension in the Chinese Han Population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25744272 2015 Role of let-7b in the regulation of N-acetylgalactosaminyltransferase 2 in IgA nephropathy.
25416956 2014 A proteome-scale map of the human interactome network.
25362349 2014 GALNT2 suppresses malignant phenotypes through IGF-1 receptor and predicts favorable prognosis in neuroblastoma.
25084356 2014 A preliminary study of the relationship between promoter methylation of the ABCG1, GALNT2 and HMGCR genes and coronary heart disease.
24740207 2014 Genome-wide association study of circulating vitamin D-binding protein.
24582885 2014 GALNT2 enhances migration and invasion of oral squamous cell carcinoma by regulating EGFR glycosylation and activity.
More...