Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.16
PubTator Score 18.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 59 1 0.0 0.0
Deafness 198 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.4e-07
osteosarcoma 7950 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 5.527 2.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.173 3.1e-02
ovarian cancer -1.500 1.4e-07

Synonym

Accession Q0ZLH3 A0PK14 B9EJE2
Symbols DFNB59

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (15)

AA Sequence

MFAAATKSFVKQVGDGGRLVPVPSLSEADKYQPLSLVVKKKRCFLFPRYKFTSTPFTLKDILLGDREISA      1 - 70
GISSYQLLNYEDESDVSLYGRRGNHIVNDVGINVAGSDSIAVKASFGIVTKHEVEVSTLLKEITTRKINF     71 - 140
DHSLIRQSRSSRKAVLCVVMESIRTTRQCSLSVHAGIRGEAMRFHFMDEQNPKGRDKAIVFPAHTTIAFS    141 - 210
VFELFIYLDGAFDLCVTSVSKGGFEREETATFALLYRLRNILFERNRRVMDVISRSQLYLDDLFSDYYDK    211 - 280
PLSMTDISLKEGTHIRVNLLNHNIPKGPCILCGMGNFKRETVYGCFQCSVDGQKYVRLHAVPCFDIWHKR    281 - 350
MK                                                                        351 - 352
//

Text Mined References (18)

PMID Year Title