Property Summary

NCBI Gene PubMed Count 18
Grant Count 35
R01 Count 23
Funding $7,635,794.08
PubMed Score 279.97
PubTator Score 64.37

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26458985 NELINinduced phenotypic transformation of human vascular smooth muscle cell was regulated via the RhoA/SRF signaling pathway.
24866383 NEXN as a novel gene for ASD and its function to inhibit GATA4 established a critical regulation of an F-actin binding protein on a transcription factor in cardiac development
24349201 This is the first study to identify NEXN as a novel coronary artery disease susceptibility gene with both genetic and functional evidence.
22381134 Nexilin is a component of the machinery that drives the formation of Listeria monocytogenes comet tails and enteropathogenic Escherichia coli pedestals.
20970104 the mutations in NEXN that we describe here may further expand the knowledge of Z-disc genes in the pathogenesis of HCM.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19881492 The findings of thi study on the role of nexilin in maintaining cardiac Z-disk integrity and on the workload dependence to cardiac Z-disk damage in nexilin-linked cardiomyopathy also might have implications for the treatment of NEXN-mutation carriers.
15823560 NELIN product is an F-actin associated protein and mediates cell motility

AA Sequence

MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQYIREREWNRR      1 - 70
KQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKRTEEERKRRIEQDMLEKRKIQ     71 - 140
RELAKRAEQIEDINNTGTESASEEGDDSLLITVVPVKSYKTSGKMKKNFEDLEKEREEKERIKYEEDKRI    141 - 210
RYEEQRPSLKEAKCLSLVMDDEIESEAKKESLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRA    211 - 280
FEEARRQMVNEDEENQDTAKIFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRN    281 - 350
MVVDDDSPEMYKTISQEFLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFEQLRQEMGEEEE    351 - 420
ENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLEIKEREAENFH    421 - 490
EEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRMQFEQREIDAALQKKREEEEE    491 - 560
EEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWWFEGEILQDGEDYQY    561 - 630
IERGETYCLYLPETFPEDGGEYMCKAVNNKGSAASTCILTIESKN                             631 - 675
//

Text Mined References (27)

PMID Year Title
26458985 2015 Regulatory mechanism of human vascular smooth muscle cell phenotypic transformation induced by NELIN.
24866383 2014 NEXN inhibits GATA4 and leads to atrial septal defects in mice and humans.
24349201 2013 NEXN is a novel susceptibility gene for coronary artery disease in Han Chinese.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22381134 2012 Nexilin is a dynamic component of Listeria monocytogenes and enteropathogenic Escherichia coli actin-rich structures.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20970104 2010 Mutations in NEXN, a Z-disc gene, are associated with hypertrophic cardiomyopathy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...