Property Summary

NCBI Gene PubMed Count 18
PubMed Score 62.61
PubTator Score 64.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 3.491 6.5e-04
acute myeloid leukemia 1.400 2.1e-02
adrenocortical carcinoma -1.667 5.9e-05
Astrocytoma, Pilocytic 1.200 2.9e-03
atypical teratoid / rhabdoid tumor 1.200 2.8e-03
Breast cancer -1.300 3.8e-09
ductal carcinoma in situ -1.100 2.1e-02
glioblastoma multiforme 1.200 5.9e-12
hepatocellular carcinoma 1.200 1.3e-02
intraductal papillary-mucinous adenoma (... -2.400 5.1e-04
intraductal papillary-mucinous carcinoma... -2.800 2.1e-04
intraductal papillary-mucinous neoplasm ... -2.700 3.2e-03
invasive ductal carcinoma 1.675 9.8e-05
lung adenocarcinoma -1.400 3.6e-13
lung carcinoma -2.800 3.0e-25
non-small cell lung cancer -1.988 6.3e-16
ovarian cancer -1.300 1.7e-04
pancreatic cancer 1.300 1.9e-02
pancreatic carcinoma 1.300 1.9e-02
tuberculosis 1.600 1.3e-04
ulcerative colitis 1.200 8.3e-03

Gene RIF (10)

AA Sequence

MNDISQKAEILLSSSKPVPKTYVPKLGKGDVKDKFEAMQRAREERNQRRSRDEKQRRKEQYIREREWNRR      1 - 70
KQEIKEMLASDDEEDVSSKVEKAYVPKLTGTVKGRFAEMEKQRQEEQRKRTEEERKRRIEQDMLEKRKIQ     71 - 140
RELAKRAEQIEDINNTGTESASEEGDDSLLITVVPVKSYKTSGKMKKNFEDLEKEREEKERIKYEEDKRI    141 - 210
RYEEQRPSLKEAKCLSLVMDDEIESEAKKESLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRA    211 - 280
FEEARRQMVNEDEENQDTAKIFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRN    281 - 350
MVVDDDSPEMYKTISQEFLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFEQLRQEMGEEEE    351 - 420
ENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEEERARRRAIDLEIKEREAENFH    421 - 490
EEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQRRIEEQKLLRMQFEQREIDAALQKKREEEEE    491 - 560
EEGSIMNGSTAEDEEQTRSGAPWFKKPLKNTSVVDSEPVRFTVKVTGEPKPEITWWFEGEILQDGEDYQY    561 - 630
IERGETYCLYLPETFPEDGGEYMCKAVNNKGSAASTCILTIESKN                             631 - 675
//

Text Mined References (27)

PMID Year Title