Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.57
PubTator Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.654 0.000
ovarian cancer 2.200 0.000
psoriasis -1.200 0.000

Synonym

Accession Q0VGL1
Symbols C7orf59

Gene

Gene RIF (1)

PMID Text
22980980 Study identified HBXIP and C7orf59 as two additional Ragulator components that are required for mTORC1 activation by amino acids.

AA Sequence

MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVF      1 - 70
GEHTLLVTVSGQRVFVVKRQNRGREPIDV                                              71 - 99
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25416956 2014 A proteome-scale map of the human interactome network.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...