Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.23
PubTator Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.5e-38
osteosarcoma 7950 1.4e-08
ovarian cancer 8520 9.6e-07

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.654 1.4e-08
ovarian cancer 2.200 9.6e-07
psoriasis -1.200 2.5e-38

Synonym

Accession Q0VGL1
Symbols C7orf59

Gene

PDB

6B9X   6EHP   6EHR  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (1)

AA Sequence

MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVF      1 - 70
GEHTLLVTVSGQRVFVVKRQNRGREPIDV                                              71 - 99
//

Text Mined References (13)

PMID Year Title