Property Summary

NCBI Gene PubMed Count 10
PubMed Score 29.51
PubTator Score 15.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.753 6.2e-07
psoriasis 2.000 1.7e-54

Gene RIF (4)

AA Sequence

MAQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATT      1 - 70
PRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLG     71 - 140
LSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQGQGQGQGQGQGQGQGQGQGQGQGQGRRPGL    141 - 210
VSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWATPPYCPKIQSPPYSSQGTTSDASLWTPPQGCPW    211 - 280
TQSSPEPRNPPVPWTAAPATLELAAVYQGLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPGRCWSHSAEVV    281 - 350
PNSEDQGPGAAFQLSEASPPQSSGLRFSGCPELWQEDLEGARLGIFY                           351 - 397
//

Text Mined References (10)

PMID Year Title