Property Summary

NCBI Gene PubMed Count 10
PubMed Score 30.65
PubTator Score 15.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.753 0.000
psoriasis 2.000 0.000

Synonym

Accession Q0VG99 Q7RTU2
Symbols SCDO2
bHLHc6

Gene

Gene RIF (4)

PMID Text
22744456 MESP2, HES7 and DUSP6 genes may not be involved in the etiopathogenesis of sporadic and non-syndromic CS in Chinese Han population.
18485326 findings suggest a founder-effect mutation in the MESP2 gene as a major cause of the classical Puerto Rican form of spondylothoracic dysostosis/Jarcho-Levin syndrome
16996494 Mesp1 is down-regulated in the later stages of development by increasing levels of Mesp2 in the wild-type embryo.
15122512 Mutated MESP2 causes spondylocostal dysostosis

AA Sequence

MAQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATT      1 - 70
PRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETLRLAIRYIGHLSAVLG     71 - 140
LSEESLQCRRRQRGDAGSPWGCPLCPDRGPAEAQTQAEGQGQGQGQGQGQGQGQGQGQGQGQGQGRRPGL    141 - 210
VSAVLAEASWGSPSACPGAQAAPERLGRGVHDTDPWATPPYCPKIQSPPYSSQGTTSDASLWTPPQGCPW    211 - 280
TQSSPEPRNPPVPWTAAPATLELAAVYQGLSVSPEPCLSLGAPSLLPHPSCQRLQPQTPGRCWSHSAEVV    281 - 350
PNSEDQGPGAAFQLSEASPPQSSGLRFSGCPELWQEDLEGARLGIFY                           351 - 397
//

Text Mined References (10)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22744456 2012 Mutation analysis of MESP2, HES7 and DUSP6 gene exons in patients with congenital scoliosis.
18485326 2008 Mutations in the MESP2 gene cause spondylothoracic dysostosis/Jarcho-Levin syndrome.
16996494 2006 Cooperative Mesp activity is required for normal somitogenesis along the anterior-posterior axis.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15122512 2004 Mutated MESP2 causes spondylocostal dysostosis in humans.
14516699 2002 Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11578861 2001 Transcriptional regulation of Mesp1 and Mesp2 genes: differential usage of enhancers during development.