Knowledge Summary

Patent

No data available

Synonym

Accession Q0VG73 Q0VG74
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MNNSFNKEDRMSSDTMVGSCDRQTKNGAKWHGGVSSLLDFTLIYIQLSTSFQNAGHSFKKQHICSDFEVM      1 - 70
DELSCAVYGNKFYYLLPTLTHPSIQ                                                  71 - 95
//

Text Mined References (2)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).