Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -2.257 8.3e-03
cystic fibrosis and chronic rhinosinusit... -1.788 2.5e-02
ependymoma 2.300 4.5e-02
nasopharyngeal carcinoma -1.700 3.2e-06

Gene RIF (1)

AA Sequence

MDTSSEMLVRFGRRCGRAKESTEIRNSEEDQVLYLPLLPSKVDLQQVTIIPHDEWKRIQDSLDRLTREAA      1 - 70
CLRAERKAKKEMHLRSQEVVKHWTNTYAGMKEQKLEAKKKRDEEIEAERQILDLEEEIYKQGKRKKAIEN     71 - 140
AKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFRKSKIKSDKKWEEQLKLNIEKAFKEEQEKAEKRHRE    141 - 210
RVALAKDHLKQIKEHEEEEERRKKYEEKDAEEIKRQNALYEIEMRKKLEKKREEMHESRRRFLEHMQDKH    211 - 280
IIKAVEQQQQEEEDEKMRKFIKAKKRLIQMGKEKEAETHRLMEKRRERIHNFLSELLKEKLDNEDMIIAR    281 - 350
DIAEAEAEWEKREREKDEKNKAELKTIAEYRAIVMKNKEEEERQRKIEAKEQLLAVMKADQIFWEHEKEK    351 - 420
KCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCRLTEALVAEKEKEFQDYAREVIELESETTNKYI    421 - 490
YPLVKAVQEGPGGGRGPVFVDRGGLRPSYQANDVTGVQLPFYNSQGPKYNFQKSKRRLGFTW            491 - 552
//

Text Mined References (5)

PMID Year Title