Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.54
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytic glioma -1.300 1.4e-02
Breast cancer -1.400 1.9e-04
facioscapulohumeral dystrophy 2.000 1.4e-03
gastric carcinoma -1.800 5.0e-02
group 3 medulloblastoma -1.700 2.0e-03
intraductal papillary-mucinous adenoma (... -1.800 1.9e-04
intraductal papillary-mucinous carcinoma... -2.100 7.3e-04
intraductal papillary-mucinous neoplasm ... -2.600 9.0e-05
lung adenocarcinoma -1.300 4.3e-11
lung carcinoma 1.100 8.5e-13
medulloblastoma, large-cell -2.100 1.1e-05
non-small cell lung cancer -2.433 1.1e-22
oligodendroglioma -1.100 4.9e-02
ovarian cancer -4.000 1.8e-18
pancreatic ductal adenocarcinoma liver m... -1.536 1.5e-02
Pick disease 1.200 1.8e-02
pituitary cancer -2.300 2.5e-06
psoriasis -1.300 7.9e-28
spina bifida -2.234 3.6e-02
subependymal giant cell astrocytoma 1.574 1.6e-02

Gene RIF (5)

AA Sequence

MELYFGEYQHVQQEYGVHLRLASDDTQKSRSSQNSKAGSYGVSIRVQGIDGHPYIVLNNTERCLAGTSFS      1 - 70
ENGPPFPPPVINNLPLHSSNGSVPKENSEELQLPENPYAQPSPIRNLKQPLLHEGKNGVLDRKDGSVKPS     71 - 140
HLLNFQRHPELLQPYDPEKNELNLQNHQPSESNWLKTLTEEGINNKKPWTCFPKPSNSQPTSPSLEDPAK    141 - 210
SGVTAIRLCSSVVIEDPKKQTSVCVNVQSCTKERVGEEALFTSGRPLTAHSPHAHPETKKTRPDVLPFRR    211 - 280
QDSAGPVLDGARSRRSSSSSTTPTSANSLYRFLLDDQECAIHADNVNRHENRRYIPFLPGTGRDIDTGSI    281 - 350
PGVDQLIEKFDQKPGLQRRGRSGKRNRINTDDRKRSRSVDSAFPFGLQGNSEYLIEFSRNLGKSSEHLLR    351 - 420
PSQVCPQRPLSQERRGKQSVGRTFAKLQGAAHGASCAHSRPPQPNIDGKVLETEGSQESTVIRAPSLGAQ    421 - 490
SKKEEEVKTATATLMLQNRATATSPDSGAKKISVKTFPSASNTQATPDLLKGQQELTQQTNEETAKQILY    491 - 560
NYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNNQACNSTSEVKDLLEQKSKLTIEVAELQRQL    561 - 630
QLEVKNQQNIKEERERMRANLEELRSQHNEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEI    631 - 700
RDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAKEEQEDLLRKRERELTALKGALKEE    701 - 770
VSSHDQEMDKLKEQYDAELQALRESVEEATKNVEVLASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEE    771 - 840
LERRVAQLQRQIEDLKGDEAKAKETLKKYEGEIRQLEEALVHARKEEKEAVSARRALENELEAAQGNLSQ    841 - 910
TTQEQKQLSEKLKEESEQKEQLRRLKNEMENERWHLGKTIEKLQKEMADIVEASRTSTLELQNQLDEYKE    911 - 980
KNRRELAEMQRQLKEKTLEAEKSRLTAMKMQDEMRLMEEELRDYQRAQDEALTKRQLLEQTLKDLEYELE    981 - 1050
AKSHLKDDRSRLVKQMEDKVSQLEMELEEERNNSDLLSERISRSREQMEQLRNELLQERAARQDLECDKI   1051 - 1120
SLERQNKDLKSRIIHLEGSYRSSKEGLVVQMEARIAELEDRLESEERDRANLQLSNRRLERKVKELVMQV   1121 - 1190
DDEHLSLTDQKDQLSLRLKAMKRQVEEAEEEIDRLESSKKKLQRELEEQMDMNEHLQGQLNSMKKDLRLK   1191 - 1260
KLPSKVLDDMDDDDDLSTDGGSLYEAPVSYTFSKDSTVASQI                               1261 - 1302
//

Text Mined References (17)

PMID Year Title