Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.300 0.001
posterior fossa group B ependymoma 1.300 0.000
glioblastoma 1.100 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
adrenocortical carcinoma 1.156 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.002
colon cancer 1.100 0.010
pilocytic astrocytoma 1.200 0.000
ovarian cancer 1.100 0.002

AA Sequence

MASETEKTHALLQTCSTESLISSLGLGAFCLVADRLLQFSTIQQNDWLRALSDNAVHCVIGMWSWAVVTG      1 - 70
IKKKTDFGEIILAGFLASVIDVDHFFLAGSMSLKAALTLPRRPFLHCSTVIPVVVLTLKFTMHLFKLKDS     71 - 140
WCFLPWMLFISWTSHHIRDGIRHGLWICPFGKTSPLPFWLYVIITSSLPHICSFVMYLTGTRQMMSSKHG    141 - 210
VRIDV                                                                     211 - 215
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.