Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.156 1.5e-05
Astrocytoma, Pilocytic 1.100 1.3e-04
atypical teratoid / rhabdoid tumor 1.100 1.6e-04
colon cancer 1.100 1.0e-02
ependymoma 1.200 7.8e-08
glioblastoma 1.100 1.6e-06
intraductal papillary-mucinous adenoma (... 1.300 2.3e-03
ovarian cancer 1.100 1.6e-03
psoriasis -1.300 5.2e-04

Synonym

Accession Q0VDI3 B2RDA6 Q9H6Z2
Symbols C5orf28

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASETEKTHALLQTCSTESLISSLGLGAFCLVADRLLQFSTIQQNDWLRALSDNAVHCVIGMWSWAVVTG      1 - 70
IKKKTDFGEIILAGFLASVIDVDHFFLAGSMSLKAALTLPRRPFLHCSTVIPVVVLTLKFTMHLFKLKDS     71 - 140
WCFLPWMLFISWTSHHIRDGIRHGLWICPFGKTSPLPFWLYVIITSSLPHICSFVMYLTGTRQMMSSKHG    141 - 210
VRIDV                                                                     211 - 215
//

Text Mined References (4)

PMID Year Title