Property Summary

NCBI Gene PubMed Count 17
PubMed Score 37.52
PubTator Score 9.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Mouth Diseases 12 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.9

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.100 2.0e-03
intraductal papillary-mucinous carcinoma... 1.100 4.5e-03
invasive ductal carcinoma -1.055 1.6e-03
lung cancer 1.400 2.8e-02
Multiple myeloma 1.544 1.6e-03
ovarian cancer 2.000 5.2e-05
spina bifida -1.141 4.6e-02

Gene RIF (13)

AA Sequence

MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNISNTVMKVKQI      1 - 70
LGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLIFSKMKETAHSVLGSDANDVV     71 - 140
ITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAYGIGQDSPTGKSNILVFKLGGTSLSLSVMEV    141 - 210
NSGIYRVLSTNTDDNIGGAHFTETLAQYLASEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANC    211 - 280
FLDSLYEGQDFDCNVSRARFELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKD    281 - 350
LFPAVELLNSIPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT    351 - 420
PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHV    421 - 490
TCTDQETGKCEAISIEIAS                                                       491 - 509
//

Text Mined References (27)

PMID Year Title