Property Summary

NCBI Gene PubMed Count 3
Grant Count 2
Funding $98,000
PubMed Score 16.00
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
15567149 Studies in mouse indicate the 80 aa SMAF1 protein is involved in adipocyte tissue function or regulation.

AA Sequence

MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTL      1 - 70
HGQEKERPCW                                                                 71 - 80
//

Text Mined References (5)

PMID Year Title
16132694 2005 Up-regulation of adipogenin, an adipocyte plasma transmembrane protein, during adipogenesis.
15567149 2005 Cloning, expression, and differentiation-dependent regulation of SMAF1 in adipogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.