Property Summary

NCBI Gene PubMed Count 3
PubMed Score 16.87
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 6.8e-05
Disease Target Count Z-score Confidence
Obesity 678 3.428 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.400 6.8e-05

Gene RIF (1)

AA Sequence

MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTL      1 - 70
HGQEKERPCW                                                                 71 - 80
//

Text Mined References (5)

PMID Year Title