Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.10
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLRATG      1 - 70
CSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGS     71 - 140
SGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSL    141 - 210
ASFSTVTARRNPLHNPWGMELAASEE                                                211 - 236
//

Text Mined References (12)

PMID Year Title