Property Summary

NCBI Gene PubMed Count 11
Grant Count 9
R01 Count 5
Funding $5,522,837.93
PubMed Score 17.22
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
21750715 Results indicate that ING5 is a growth suppressor with suppressed expression in AML whose functions depend on its interaction with INCA1.
21540187 Inhibitor of cyclin-dependent kinase (CDK) interacting with cyclin A1 (INCA1) regulates proliferation and is repressed by oncogenic signaling

AA Sequence

MQVQDDGVNLIPFAKCSRVVSRSPPPRLPSQSLRPMPQRYGDVFWKNLNQRPTPTWLEEQHIPPMLRATG      1 - 70
CSQLGLYPPEQLPPPEMLWRRKKRRPCLEGMQQQGLGGVPARVRAVTYHLEDLRRRQSIINELKKAQWGS     71 - 140
SGAASEPVVLGEEGCGFPSTNEYPDLEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSL    141 - 210
ASFSTVTARRNPLHNPWGMELAASEE                                                211 - 236
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21874239 Zinc finger protein HZF1 promotes K562 cell proliferation by interacting with and inhibiting INCA1.
21750715 2011 The inhibitor of growth protein 5 (ING5) depends on INCA1 as a co-factor for its antiproliferative effects.
21540187 2011 Inhibitor of cyclin-dependent kinase (CDK) interacting with cyclin A1 (INCA1) regulates proliferation and is repressed by oncogenic signaling.
18756329 2008 A novel testis protein, RSB-66, interacting with INCA1 (inhibitor of Cdk interacting with cyclin A1).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16148011 2005 Inhibition of the calcineurin-NFAT interaction by small organic molecules reflects binding at an allosteric site.
15800920 2005 Expression patterns of mitotic and meiotic cell cycle regulators in testicular cancer and development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...