Property Summary

NCBI Gene PubMed Count 8
PubMed Score 11.53
PubTator Score 10.63

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.55945624063118E-7
osteosarcoma 7933 5.50997750056815E-5
Disease Target Count Z-score Confidence
Atherosclerosis 275 0.0 4.0


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.969 0.000
lung adenocarcinoma -1.200 0.000


Accession Q0VD83 H3BU97 Q0VD81 Q8NC15 Q9NPJ9
Symbols APOB48R


  Ortholog (6)

Gene RIF (5)

23519644 The obesity risk alleles of non-synonymous SNPs at SH2B1 and APOB48R have no strong effect on weight loss-related phenotypes in overweight children after a 1-year lifestyle intervention.
22190030 These findings suggest that APOB48R represents a molecular target of postprandial lipoproteins via PPAR-dependent pathways in human monocytes and macrophages and advance an important link between postprandial metabolism of dietary fats and atherogenesis.
21367954 investigation of apoB48R gene transcription in circulating monocytes: increase in apoB48R gene transcription following high-fat meal
15830122 Nucleotide variations in the apolipoprotein B48 receptor gene is associated with hypercholesterolemia
15591219 Atherogenic remnant lipoproteins induced macrophage foam cell formation via apoB48R, indicating a potential role of apoB48R in atherosclerosis.

AA Sequence

HDGTPVPARRRPLGHGFGLAHPGMMQELQARLGRPKPQ                                   1051 - 1088

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23519644 2013 Analyses of non-synonymous obesity risk alleles in SH2B1 (rs7498665) and APOB48R (rs180743) in obese children and adolescents undergoing a 1-year lifestyle intervention.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190030 2012 Triglyceride-rich lipoprotein regulates APOB48 receptor gene expression in human THP-1 monocytes and macrophages.
21367954 2011 A high-fat meal promotes lipid-load and apolipoprotein B-48 receptor transcriptional activity in circulating monocytes.
19946888 2010 Defining the membrane proteome of NK cells.
15830122 2005 Association of nucleotide variations in the apolipoprotein B48 receptor gene (APOB48R) with hypercholesterolemia.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15591219 2005 Pitavastatin inhibits remnant lipoprotein-induced macrophage foam cell formation through ApoB48 receptor-dependent mechanism.