Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.95
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.100 1.9e-03
atypical teratoid / rhabdoid tumor 2.900 1.1e-05
Chronic Lymphocytic Leukemia -1.099 2.2e-04
cystic fibrosis 1.781 1.2e-06
glioblastoma 1.100 2.6e-04
group 4 medulloblastoma 1.100 3.1e-04
interstitial cystitis -1.300 2.7e-04
intraductal papillary-mucinous adenoma (... 2.300 8.5e-05
intraductal papillary-mucinous carcinoma... 1.800 1.5e-03
intraductal papillary-mucinous neoplasm ... 2.500 1.8e-03
invasive ductal carcinoma -1.069 9.1e-04
lung cancer -1.100 8.3e-04
malignant mesothelioma -3.800 2.1e-09
ovarian cancer 1.200 1.1e-05
pancreatic cancer 1.700 2.2e-08
psoriasis 1.100 5.2e-12
spina bifida -1.981 3.6e-02

AA Sequence

MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYE      1 - 70
PTEGEPSAIVQMESDLAKGSEKEEYFI                                                71 - 97
//

Text Mined References (8)

PMID Year Title