Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.85
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia -1.099 2.2e-04
malignant mesothelioma -3.800 2.1e-09
glioblastoma 2.100 3.2e-04
cystic fibrosis 1.781 1.2e-06
atypical teratoid / rhabdoid tumor 2.900 1.1e-05
medulloblastoma 1.200 2.0e-04
intraductal papillary-mucinous adenoma (... 2.300 8.5e-05
intraductal papillary-mucinous carcinoma... 1.800 1.5e-03
intraductal papillary-mucinous neoplasm ... 2.500 1.8e-03
lung cancer -1.100 8.3e-04
pancreatic cancer 1.700 2.2e-08
interstitial cystitis -1.300 2.7e-04
pediatric high grade glioma 1.500 4.2e-04
invasive ductal carcinoma -1.069 9.1e-04
psoriasis 1.100 5.2e-12
spina bifida -1.981 3.6e-02
ovarian cancer 1.200 1.1e-05

AA Sequence

MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYE      1 - 70
PTEGEPSAIVQMESDLAKGSEKEEYFI                                                71 - 97
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15986429 2005 Overexpression of the small transmembrane and glycosylated protein SMAGP supports metastasis formation of a rat pancreatic adenocarcinoma line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15021913 2004 SMAGP, a new small trans-membrane glycoprotein altered in cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.