Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.52
PubTator Score 3.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count P-value
pancreatic cancer 2398 2.9e-03
pancreatic carcinoma 562 2.9e-03
Rheumatoid arthritis 1191 7.6e-03
spina bifida 1074 8.1e-03
diabetes mellitus 1728 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 3.497 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.500 2.3e-02
pancreatic cancer 1.400 2.9e-03
pancreatic carcinoma 1.400 2.9e-03
Rheumatoid arthritis 1.800 7.6e-03
spina bifida -1.625 8.1e-03

Gene RIF (3)

AA Sequence

MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFTFLLSS      1 - 70
RLFMHPYELMAKVCHLCVEHQRLSDPDSDKNQMRKIAPKILQLLTEWTETFPYDFRDERMMRNLKDLAHR     71 - 140
IASGEEQTYRKNVQQMMQCLIRKLAALSQYEEVLAKISSTSTDRLTVLKTKPQSIQRDIITVCNDPYTLA    141 - 210
QQLTHIELERLNYIGPEEFVQAFVQKDPLDNDKSCYSERKKTRNLEAYVEWFNRLSYLVATEICMPVKKK    211 - 280
HRARMIEYFIDVARECFNIGNFNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDILEHQMDPSSNFYNYRT    281 - 350
ALRGAAQRSLTAHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFWELAKQVSEFMTWKQVEC    351 - 420
PFERDRKILQYLLTVPVFSEDALYLASYESEGPENHIEKDRWKSLRSSLLGRV                     421 - 473
//

Text Mined References (12)

PMID Year Title