Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.26
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
NEMALINE MYOPATHY 10 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.4
Disease Target Count Z-score Confidence
Nemaline myopathy 17 6.343 3.2
Disease Target Count Z-score Confidence
Congenital myopathy 16 5.407 2.7
Neonatal respiratory failure 2 4.356 2.2

Expression

Gene RIF (2)

AA Sequence

MSEHSRNSDQEELLDEEINEDEILANLSAEELKELQSEMEVMAPDPSLPVGMIQKDQTDKPPTGNFNHKS      1 - 70
LVDYMYWEKASRRMLEEERVPVTFVKSEEKTQEEHEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNI     71 - 140
QETDEEDEEEEDDDDDDEGEDDGEESEETNREEEGKAKEQIRNCENNCQQVTDKAFKEQRDRPEAQEQSE    141 - 210
KKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKK    211 - 280
NKHIKTFSLANVGADENVAFALANMLRENRSITTLNIESNFITGKGIVAIMRCLQFNETLTELRFHNQRH    281 - 350
MLGHHAEMEIARLLKANNTLLKMGYHFELPGPRMVVTNLLTRNQDKQRQKRQEEQKQQQLKEQKKLIAML    351 - 420
ENGLGLPPGMWELLGGPKPDSRMQEFFQPPPPRPPNPQNVPFSQRSEMMKKPSQAPKYRTDPDSFRVVKL    421 - 490
KRIQRKSRMPEAREPPEKTNLKDVIKTLKPVPRNRPPPLVEITPRDQLLNDIRHSSVAYLKPVQLPKELA    491 - 560
//

Text Mined References (12)

PMID Year Title