Property Summary

NCBI Gene PubMed Count 3
Grant Count 33
R01 Count 32
Funding $5,581,662.68
PubMed Score 132.88
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

Gene RIF (1)

PMID Text
24007603 Additional serum biomarkers, particularly SYCN and REG1B, when combined with CA19.9, show promise as improved diagnostic indicators of pancreatic cancer, which therefore warrants further validation.

AA Sequence

MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYENCCGGAELSLESGADLPYLP      1 - 70
SNWANTASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCS           71 - 134
//

Text Mined References (4)

PMID Year Title
24007603 2013 Validation of four candidate pancreatic cancer serological biomarkers that improve the performance of CA19.9.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11839820 2002 Loss of the zymogen granule protein syncollin affects pancreatic protein synthesis and transport but not secretion.