Property Summary

NCBI Gene PubMed Count 3
PubMed Score 134.40
PubTator Score 8.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q0VAF6
Symbols SYL
INSSA1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYENCCGGAELSLESGADLPYLP      1 - 70
SNWANTASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNAISALYCRCS           71 - 134
//

Text Mined References (4)

PMID Year Title