Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.40
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.08572806216273E-35

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.400 0.000

Synonym

Accession Q0VAA5 Q96N12
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
23333304 HIV-1 Vif upregulates the expression of phosphatidylinositol-specific phospholipase C, X domain containing 2 (PLCXD2) in Vif-expression T cells
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLAVRKARRKLRMGTICSPNPSGTKTSSEVCNADWMASLPPHLHNLPLSNLAIPGSHDSFSYWVDEKSPV      1 - 70
GPDQTQAIKRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDADQEIYFIHGLFGIKVW     71 - 140
DGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVL    141 - 210
IFYHCPFYKQYPFLWPGKKIPAPWANTTSVRKLILFLETTLSERASRGSFHVSQAILTPRVKTIARGLVG    211 - 280
GLKNTLVHSNRWNSHGPSLLSQERS                                                 281 - 305
//

Text Mined References (7)

PMID Year Title
22732399 2012 Cloning, tissue distribution and sub-cellular localisation of phospholipase C X-domain containing protein (PLCXD) isoforms.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.