Property Summary

NCBI Gene PubMed Count 7
PubMed Score 74.28
PubTator Score 2.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.1e-07
pancreatic ductal adenocarcinoma liver metastasis 1962 5.6e-03
Disease Target Count Z-score Confidence
Riley-Day syndrome 11 4.107 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.591 4.1e-07
pancreatic ductal adenocarcinoma liver m... -1.080 5.6e-03

Synonym

Accession Q0PNE2 Q9BW57 Q9NXJ3
Symbols C3orf75
TMEM103

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MFVELNNLLNTTPDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALIQSFSHYSIVGQKLGV      1 - 70
SLTMARERGQLVFLEGLKSAVDVVFQAQKEPHPLQFLREANAGNLKPLFEFVREALKPVDSGEARWTYPV     71 - 140
LLVDDLSVLLSLGMGAVAVLDFIHYCRATVCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRA    141 - 210
EGLATGFCRDVHGQLRILWRRPSQPAVHRDQSFTYQYKIQDKSVSFFAKGMSPAVL                  211 - 266
//

Text Mined References (8)

PMID Year Title