Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
lung cancer 1.400 3.0e-02
adult high grade glioma 1.300 4.0e-03
atypical teratoid / rhabdoid tumor 1.500 9.7e-07
ependymoma 1.600 1.2e-07
glioblastoma 1.800 1.3e-06
group 3 medulloblastoma 1.800 1.5e-03
malignant mesothelioma 1.200 1.1e-04
medulloblastoma, large-cell 1.800 2.2e-05
ovarian cancer -1.300 1.3e-04
primitive neuroectodermal tumor 1.800 3.6e-06

Synonym

Accession Q0P6D6 Q9H8U7
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (1)

AA Sequence

MLGSMARKKPRNTSRLPLALNPLKSKDVLAVLAERNEAIVPVGAWVEPASPGSSEIPAYTSAYLIEEELK      1 - 70
EQLRKKQEALKHFQKQVKYRVNQQIRLRKKQQLQKSYERAQKEGSIAMQSSATHLTSKRTSVFPNNLNVA     71 - 140
IGSSRLPPSLMPGDGIEDEENQNELFQQQAQALSETMKQARHRLASFKTVIKKKGSVFPDDGRKSFLTRE    141 - 210
EVLSRKPASTGINTGIRGELPIKVHQGLLAAVPYQNYMENQELDYEEPDYEESSSLVTDEKGKEDLFGRG    211 - 280
QQDQQAIHSEDKNKPFSRVQKVKFKNPLFVLMEEEEQKQLHFEGLQDILPEAQDYFLEAQGDLLETQGDL    281 - 350
TGIQSVKPDTQAVEMKVQVTEPEGQAIEPEGQPIKTETQGIMLKAQSIELEEGSIVLKTQDFLPTNQALL    351 - 420
TKNQDVLLKDHCVLPKDQSILLKYQDQDFLPRDQHVLHKDQDILPKYQDQNFLPKDQNFLSRDQHVLPKD    421 - 490
QDILPKYQDQNFLPKDQNFLSRDQHVLPKDQNILPKYQGQDFLPKDQDFLSRDQHVLPKDWNILPKCQDQ    491 - 560
DFLPRDQGVLPKDQNILPICQDQDFLPRDQGYLPKDQNILPICQDRDFLPRDLHVLSNDQNILPKCQDQD    561 - 630
FLPKYQKVHFKEPYSDMTDEKGREDFSLADYQCLPPKSQDQDDIKNQQPASFMREERVREELPLDYHQYV    631 - 700
VPKIQDQDSPREQNKHIKLPSSFEKWEIARGNTPGVPLAYDRYQSGLSTEFQAPLAFQSDVDKEEDKKER    701 - 770
QKQYLRHRRLFMDIEREQVKEQQRQKEQKKKIEKIKKKREQECYAAEQRILRMNFHEDPYSGEKLSEILA    771 - 840
QLQLQEIKGTREKQQREKEYLRYVEALRAQIQEKMQLYNITLPPLCCCGPDFWDAHPDTCANNCIFYKNH    841 - 910
RAYTRALHSFINSCDVPGGNSTLRVAIHNFASAHRRTLKNL                                 911 - 951
//

Text Mined References (8)

PMID Year Title