Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.48
PubTator Score 0.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 3.2e-07
group 3 medulloblastoma -1.300 3.4e-03
medulloblastoma, large-cell -1.200 8.4e-05
osteosarcoma 1.532 1.0e-07
posterior fossa group B ependymoma 1.200 5.6e-04

Gene RIF (1)

AA Sequence

MARAAGARGPAGWCRRRGRCGRGTLLAFAAWTAGWVLAAALLLRAHPGVLSERCTDEKSRRILAALCQDY      1 - 70
QGGTLAGDLCEDLCVAGELLFQRCLHYNRGKKVLQADWRGRPVVLKSKEEAFSSFPPLSLLEEEAGEGGQ     71 - 140
DMPEAELLLMVAGEVKSALGLELSNSSLGPWWPGRRGPRWRGQLASLWALLQQEEYVYFSLLQDLSPHVL    141 - 210
PVLGSCGHFYAVEFLAAGSPHHRALFPLDRAPGAPGGGQAKAISDIALSFLDMVNHFDSDFSHRLHLCDI    211 - 280
KPENFAIRSDFTVVAIDVDMAFFEPKMREILEQNCTGDEDCNFFDCFSRCDLRVNKCGAQRVNNNLQVIC    281 - 350
DKIFRHWFSAPLKSSAVSFQLQLQLQEAVQECADPGVPSGNTRRAASSVFWKLRQLLQATLRELQEAEK     351 - 419
//

Text Mined References (6)

PMID Year Title